KEGG   Corynebacterium glutamicum R: cgR_2169Help
Entry
cgR_2169          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    cgR_2169
Enzymes [BR:cgt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     cgR_2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2391947..2394067
Genome map
AA seq 706 aa AA seqDB search
MTARRLLNELADLYGVATSYTDYKGAHIEVSDDTLVKILRALGVHLDTSNLPNDDAIQRQ
IALFHDREFTRPLPPSVVAVEGDELVFPVHVHDGSPADVHIELEDGTQRDVSQVENWTAP
REIDGIRWGEASFKIPGDLPLGWHKLHLKSNERSAECGLIITPARLSTADKYLDSPRSGV
MAQIYSVRSTLSWGMGDFNDLGNLASVVAQDGADFLLINPMHAAEPLPPTEDSPYLPTTR
RFINPIYIRVEDIPEFNQLEIDLRDDIAEMAAEFRERNLTSDIIERNDVYAAKLQVLHAI
FEMPRSSEREANFVSFVQREGQGLIDFATWCADRETAQSESVHGTEPDRDELTMFYMWLQ
WLCDEQLAAAQKRAVDAGMSIGIMADLAVGVHPGGADAQNLSHVLAPDASVGAPPDGYNH
QGQDWSQPPWHPVRLAEEGYIPWRNLLRTVLRHSGGIRVDHVLGLFRLFVMPRMQSPATG
TYIRFDHNALVGILALEAELADAVVIGEDLGTFEPWVQDVLAQRGIMGTSILWFEHSPSQ
PGPRRQEEYRPLALTSVTTHDLPPTAGYLEGEHIALRERLGVLNTDPAAEDAEDLQWQAE
ILDVAASANALPAREYVGLERDQRGELVELLEGLHTFVAKTPSALTCVSLVDMVGEKRAQ
NQPGTTRDMYPNWCIPLCDNEGNSVLIESLRENELYHRVAKASKRD
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctcgcagacttttgaatgaactcgccgatctctacggcgtagcaacttcctac
actgattacaaaggtgcccatattgaggtcagcgatgacacattagtgaaaatcctgcgt
gctctgggcgtgcatttagatacaagcaacctccccaacgatgacgccatccaacgccaa
attgccctcttccatgatcgagagttcactcgcccactgcctccatcggtggttgcagtt
gaaggtgatgaactagttttcccggtgcatgtgcacgacggttcccctgcagatgtccac
atcgaattggaagacggcacgcagcgggatgtttctcaggtggaaaactggacagcgcca
cgggaaattgatgggattaggtggggcgaggcatcgtttaagattcctggtgatctcccc
ttgggttggcacaagcttcaccttaaatccaacgaacgctcagctgagtgcggtttgatc
atcaccccggctcgtctgtctactgctgataagtatcttgattcccctcgcagtggtgtc
atggcgcagatctactctgtgcgttccacgttgtcgtggggcatgggtgatttcaatgat
ttaggaaacttggcaagtgtggttgcccaggatggagcagacttcctgctcatcaacccc
atgcacgctgcagagccgctgcctcctactgaggactctccttatctgcccacaaccagg
cgctttatcaacccgatctacattcgggtagaagatattccggagtttaatcagcttgag
attgatctacgcgatgatatcgcagagatggctgcggaattccgcgaacgcaatctgacc
tcagacatcattgagcgcaatgacgtctacgctgcaaagcttcaagtgctgcacgccatt
tttgaaatgcctcgttccagcgaacgtgaagccaactttgtctccttcgtgcaacgcgaa
ggccaaggtcttattgatttcgccacctggtgcgcagaccgcgaaactgcacagtctgaa
tctgtccacggaactgagccagaccgcgatgagctgaccatgttctacatgtggttgcag
tggctatgtgatgagcagctggcggcagctcaaaagcgcgctgtcgatgccggaatgtcg
atcggcatcatggcagacctggcagttggtgtgcatccaggtggtgctgatgcccagaac
ctcagccacgtacttgctccggatgcgtcagtgggcgccccaccagatggatacaaccac
cagggccaagactggtcccagccaccatggcatccagtgcgtcttgcagaggaaggctac
attccgtggcgtaatctgctgcgcactgtgctgcgtcactccggcggaatccgcgtggac
cacgttcttggtttgttcaggctctttgtcatgccacgcatgcaatcccctgctacgggc
acctatatccgcttcgaccataatgcgttggtaggcattctagccctagaagcagaactc
gcagacgccgttgtcattggtgaagatctgggaacgtttgagccttgggtacaagatgta
ttggctcagcgtggcatcatgggcacctcgatcctatggttcgagcattccccaagccag
ccgggtcctcgccgccaggaagagtatcgtccgctggccttgacctctgtgaccactcat
gatctccctccgactgctggttatttggagggcgagcacattgctcttcgtgagcgattg
ggtgtgctcaacactgatcctgctgcagaagacgctgaggatctgcagtggcaagcggag
atccttgatgtcgcagcatctgccaacgcattgccagcccgggaatacgtgggactcgaa
cgcgatcagcgcggtgagttggttgagctgttggaaggcctgcacactttcgttgcgaaa
accccttcagcactgacctgtgtctccttggtagacatggtcggtgaaaagcgggcacag
aatcagccgggcacaacgagggatatgtatcccaactggtgtatcccactgtgtgacaac
gaaggcaactccgtgctcattgaatcgctgcgtgaaaatgagctgtatcaccgtgtggcg
aaggcaagcaagcgagattag

DBGET integrated database retrieval system