KEGG   Corynebacterium glutamicum R: cgR_2239Help
Entry
cgR_2239          CDS       T00501                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cgR_2239
  Amino acid metabolism
   00330 Arginine and proline metabolism
    cgR_2239
Enzymes [BR:cgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     cgR_2239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2468382..2469602)
Genome map
AA seq 406 aa AA seqDB search
MTGLPVTPYSQEASIGASFPAVDPDTKDSAAYGHESGMRERISNAKRVVVKIGSSSLTND
EDGHTVDPNRINTIVNALQARMEAGSDLIVVSSGAVAAGMAPLGLSTRPTELAVKQAAAA
VGQVHLMHQWGRSFARYGRPIGQVLLTAADAGKRDRARNAQRTIDKLRILGAVPIVNEND
TVATTGVNFGDNDRLAAIVAHLVSADALVLLSDVDGLFDKNPTDPTAKFISEVRDGNDLK
GVIAGDGGKVGTGGMASKVSAARLASRSGVPVLLTSAANIGPALEDAQVGTVFHPKDNRL
SAWKFWALYAADTAGKIRLDDGAVEAVTSGGKSLLAVGITEIIGDFQQGEIVEILGPAGQ
IIGRGEVSYDSDTLQSMVGMQTQDLPDGMQRPVVHADYLSNYASRA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgacagggcttcccgtcaccccctacagccaggaagcaagcatcggtgcgagcttcccg
gcagtggatccggacaccaaagacagcgccgcatacggacatgaatccggaatgcgtgag
cgcatctccaacgctaagcgagtggtggtgaaaattggttcgtcctcattgactaacgat
gaggatggacacaccgtcgatcccaaccgcatcaacactattgtcaatgccttgcaagca
cgcatggaagctggctcggacctcatcgttgtgtcctctggcgcagtggccgcgggaatg
gctccacttggattgagcactcggcccacggaattggcagtcaagcaggctgcagcagca
gtggggcaagttcacctcatgcaccagtggggacgttcttttgcccggtatggtcgcccc
atcggccaggtgcttcttaccgcagctgatgcaggaaagcgtgatcgtgcgaggaatgcg
cagcgtaccatcgacaagctgcgcattttgggcgcggttcctatcgtcaatgaaaatgac
accgtggcaaccaccggtgtgaattttggtgacaacgaccgacttgctgcaattgtggcg
cacctggtgtcggctgatgctttggtgctgctcagtgacgtggatggactttttgataag
aaccctactgatcccaccgcgaagtttatttccgaggttcgtgacggcaatgatttgaaa
ggtgtcattgccggcgacggcggaaaagtgggcaccggtggcatggcatcaaaggtgtct
gctgcacgtttggcttcccgaagtggcgtgcctgtgctgttgacctctgcggcaaacatt
ggcccagcactggaagacgcccaggtgggcactgtattccaccccaaggacaaccgcctc
tccgcgtggaagttctgggctttgtatgccgcagatactgcaggaaagatccgacttgat
gatggcgcggtggaagcagtgacctccggtggtaaatctttgctggctgtgggcattact
gaaatcattggtgatttccaacagggtgagatcgtggagatcttgggacctgccggccaa
atcatcgggcgaggcgaggtgtcctacgattctgataccttgcaatcaatggttggtatg
caaacgcaggaccttccagatggcatgcagcgcccggtagtgcatgcagattatctgtcc
aactacgccagccgcgcgtaa

DBGET integrated database retrieval system