KEGG   Corynebacterium glutamicum R: cgR_2392Help
Entry
cgR_2392          CDS       T00501                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cgt00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cgt00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:cgt00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2628273..2629589)
Genome map
AA seq 438 aa AA seqDB search
MSRCEPQNLSCTRVYSAKEITSLDSMLTMPIPEYLHEILDDVRDTTSGELADYIPELKSA
DPNPLAVALCTVNGHIYSAGDDDVAFTMQSISKPFAYALALQECGFDEVSASVALEPSGE
AFNELSLDGENRPMNPMINAGAIAINQLINGSDSTVEDRVEKIRQYFSELAGRELTIDRV
LAESELAGADRNLSIAHMLRNYGVIEDEAHDAVLSYTLQCAIKVTTRDLAVMTATLAAGG
THPITGKKLLDARVCRLTLSVMASAGMYDEAGQWLSTVGIPAKSGVAGGLIGILPGQLGI
ATFSPRLNPKGNSVRGVEIFKQLSDDMGLHLMSTEQVSGHAVRSITRDGDTTFIQMQGAM
NFSASESFLHAIVEHNFEGTEVVLDLTRVLSFHPVAIRMIKEGLKRIRDAGFEVFILDPD
GVLPDFMFSDGTICKERV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcgctgtgagccccagaatctgtcatgcacaagagtatatagcgcaaaagaaatc
actagtcttgattctatgttgacgatgccgatacccgagtacctgcacgaaattttagat
gatgtccgcgacaccacctccggcgagttggccgattacatcccggaactaaaatctgcg
gacccaaacccgctggcagtagccctgtgcaccgtcaacggacacatttacagcgcgggc
gacgacgacgtggcattcaccatgcaaagtatttccaagccctttgcctacgcactcgca
ctccaagaatgcggctttgatgaggtctctgcatccgtggccttggaaccctccggtgag
gccttcaacgaactttccctcgacggcgaaaaccgccccatgaaccccatgatcaacgcc
ggtgcgatcgccatcaaccagctgatcaacggctccgattccaccgtggaagaccgcgtg
gaaaaaatccgacagtacttctctgaacttgctggacgcgaacttaccatcgaccgcgtg
cttgccgaatccgaactcgccggcgccgaccgcaacctctccatcgcccacatgctgcgc
aactatggcgtcatcgaagacgaagcccacgacgccgtcctcagctacacgctgcaatgc
gccatcaaagtaaccacgcgcgacctcgcagtcatgaccgccacgctcgccgccggcggc
acgcacccaattaccggcaagaagcttctcgacgcccgcgtctgccgcctcaccctctcc
gtcatggcttcagcaggcatgtacgacgaggcagggcagtggctctccaccgtaggcatc
cccgcgaaatcaggagtcgccggcggactcatcggcattctgccaggtcagctgggcatc
gccacattttccccacgcctgaaccccaaaggcaacagcgtgcgcggcgtagaaatattc
aaacagctttccgacgacatgggcctccacctcatgtccaccgagcaggtatccggccac
gcagtacgatccatcacgcgggacggcgacaccaccttcatccaaatgcagggcgccatg
aacttctcagccagcgaaagcttcctccacgccatcgtggaacacaactttgaaggtacc
gaagttgttcttgatctcacccgagtacttagcttccaccccgtagccatccgcatgatc
aaagaaggcctcaaacgcatccgcgacgcaggctttgaggtgttcatcctcgacccagat
ggcgtactgcccgatttcatgttttccgacggcaccatctgcaaagaacgagtgtga

DBGET integrated database retrieval system