KEGG   Corynebacterium glutamicum R: cgR_2407Help
Entry
cgR_2407          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cgt00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:cgt00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2651641..2652402)
Genome map
AA seq 253 aa AA seqDB search
MSQSTNISLEGRTALITGGASGIGAACARAFSRAGATVTVCDRNEQAAKELAEEIGGDYW
AVDLSDTKALEFLTLDVDILVNNAGSQKVAPIHEFVPDDWRFIHKLMLESPFLLIRAALP
AMYERGFGRIINISSIHGLRASAFKSAYVAAKHGLESLSKVTALEGAEYGVTSNCMNPSY
VRTALVEKQIKDQAVTHGIAPEEVVEKIMLTESAIKGLVDADEVASLVTWLASDMAGMVT
GASYTVDGGWTAS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtccaccaacatttcacttgaaggtcgcacagctttgattactggaggtgca
tctgggattggggcggcttgtgctcgtgcgttctctcgggcaggtgccacagtgacggtg
tgtgatcggaatgagcaggcagcgaaagagttggctgaagaaattgggggagattactgg
gccgtggatctctcagataccaaggcgttggagtttctcaccttagatgtggatattttg
gtcaataacgccggtagtcaaaaagtcgcgccgattcatgagttcgttccggatgattgg
cgcttcattcacaagctgatgttggaatcccctttccttctaattcgtgccgcattgccc
gcgatgtatgagcgtggattcggacgcatcattaatatttcctccatccatgggcttcgt
gcgagtgcttttaaatcggcgtatgtggctgcaaagcatggcctggaaagcctttcgaaa
gttacggccctggagggtgcggaatatggggtgacatctaactgcatgaatccttcttat
gtgcggactgctttagtggagaaacagattaaagatcaggcagtcacacatggcattgct
ccagaagaagtggtggagaagatcatgcttacagaatctgcgataaagggacttgtcgat
gcggatgaggtcgcctctttggtcacgtggctggcatccgacatggcgggcatggttacc
ggcgcgtcttacaccgtggatggtggctggacagccagctag

DBGET integrated database retrieval system