KEGG   Corynebacterium glutamicum R: cgR_2469Help
Entry
cgR_2469          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00020  Citrate cycle (TCA cycle)
cgt00640  Propanoate metabolism
cgt00660  C5-Branched dibasic acid metabolism
cgt01100  Metabolic pathways
cgt01110  Biosynthesis of secondary metabolites
cgt01120  Microbial metabolism in diverse environments
cgt01130  Biosynthesis of antibiotics
cgt01200  Carbon metabolism
Module
cgt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cgR_2469
   00640 Propanoate metabolism
    cgR_2469
   00660 C5-Branched dibasic acid metabolism
    cgR_2469
Enzymes [BR:cgt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     cgR_2469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAF55480
UniProt: A4QGW4
Position
complement(2724373..2725581)
Genome map
AA seq 402 aa AA seqDB search
MELAVDLFEYQARDLFETHGVPVLKGIVASTPEAARKAAEEIGGLTVVKAQVKVGGRGKA
GGVRVAPTSAQAFDAADAILGMDIKGHTVNQVMVAQGADIAEEYYFSILLDRANRSYLAM
CSVEGGMEIEILAKEKPEALAKVEVDPLTGIDEDKAREIVTAAGFETEVAEKVIPVLIKI
WQVYYEEEATLVEVNPLVLTDGGDVIALDGKITLDDNADFRHDNRGALAESAGGLDILEL
KAKKNDLNYVKLDGSVGIIGNGAGLVMSTLDIVAAAGERHGGQRPANFLDIGGGASAESM
AAGLDVILGDSQVRSVFVNVFGGITACDVVAKGIVGALDVLGDQATKPLVVRLDGNNVVE
GRRILAEYNHPLVTVVEGMDAAADHAAHLANLAQHGQFATAN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaattggcagtggatctttttgaataccaagcacgggacctctttgaaacccatggt
gtgccagtgttgaagggaattgtggcatcaacgccagaggcggcgaggaaagcggctgag
gaaatcggcggactgaccgtcgtcaaggctcaggtcaaggtgggcggacgtggcaaggcg
ggtggcgtccgtgtggcaccgacgtcggctcaggcttttgatgctgcggatgcgattctc
ggcatggatatcaaaggccacactgttaatcaggtgatggtggcgcagggcgctgacatt
gctgaggaatactatttctccattttgttggatcgcgcgaatcgttcgtatctggctatg
tgctctgttgaaggtggcatggagatcgagatcctggcgaaggaaaagcctgaagctttg
gcaaaggtggaagtggatcccctcactggtattgatgaggacaaagcgcgggagattgtc
actgctgctggctttgaaactgaggtggcagagaaagtcattccggtgctgatcaagatc
tggcaggtgtattacgaagaggaagcaacactcgttgaggtgaacccgttggtgctcacg
gatggcggcgatgtgattgcgcttgatggcaagatcacgctggatgataacgctgatttc
cgccatgataaccgtggtgcgttggctgaatctgccggtggcttggacattttggaactg
aaggccaagaagaatgatctgaactacgtgaaacttgatggctctgtgggcatcattggc
aatggtgcaggtttggtgatgtccacgttggatatcgtggctgcagctggtgaacgccat
ggtgggcagcgccccgcgaacttcctagacattggtggcggagcatcagctgaatcgatg
gctgctggtctcgatgtgatccttggggatagccaggtacgcagtgtgtttgtgaatgtg
tttggtggcatcaccgcgtgtgatgtggtggcaaagggaatcgttggagctttggatgtg
ctcggtgatcaagcaacgaagcctcttgtggtgcgccttgatggcaacaacgtggtggaa
ggcagacgaatcctcgcggaatataaccaccctttggtcaccgttgtggagggtatggat
gcagcggctgatcacgctgcccatttggccaatcttgcccagcacggccagttcgcaacc
gctaattag

DBGET integrated database retrieval system