KEGG   Corynebacterium glutamicum R: cgR_2486Help
Entry
cgR_2486          CDS       T00501                                 

Definition
phosphoribosylaminoimidazole synthetase (EC:6.3.3.1)
Orthology
K01933  
phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    cgR_2486
Enzymes [BR:cgt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     cgR_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2743866..2744942)
Genome map
AA seq 358 aa AA seqDB search
MSDHQDTTAEGVSYAAAGVDIEAGDRAVELFAPMAKRATRPEVLGNLGGFAGLFELGKYK
KPILAAGSDGVGTKLVIAQMMDKHDTIGIDLVAMCVDDLVVTGAEPLFLQDYIAIGKVVP
EHVAEIVSGIAEGCVQAGCALLGGETAEHPGVMEPDHYDVSATAVGVVEADELLGPDRVR
AGDVLIGMASSGLHSNGYSLARHVLLEKAGLALDGHIEELGRTLGEELLEPTRIYAKDCL
ALIAECEVHTFCHVTGGGLAGNLERVIPEGLVAEMSRATWTPGQIFRTISSVGKVSREEM
EKTFNMGVGMVAVVAEKDRDRALAMLTARHIDCWEIGTVRNGEEGEPRVILNGEHPGY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcaccaggacaccaccgccgaaggcgtttcatacgcagcagcaggagtcgac
atcgaagccggcgatcgtgccgtcgaactctttgcaccaatggccaagcgcgccacccgc
ccagaggttcttggcaacctcggaggcttcgcaggactctttgagctcggaaaatacaag
aagccaatcctcgcagcaggatctgacggagtcggcaccaagcttgtcatcgcccagatg
atggacaagcacgacaccatcggcatcgaccttgttgcaatgtgtgtggatgacctcgtt
gtcaccggcgcagagccactgttcctccaggactacatcgccatcggcaaggttgtccca
gagcacgttgctgagatcgtctccggtatcgcagaaggctgtgtccaggcaggctgtgct
ctgctcggtggcgaaaccgcagaacacccaggtgttatggaaccagaccactacgatgtc
tccgcaactgcggtcggcgttgtcgaagcagatgaactgctaggaccagaccgcgtccgc
gcaggcgacgtcctcatcggcatggcttcctccggtctgcactccaacggttactccctg
gctcgccacgtcctcctggaaaaggcaggcctggcgcttgacggacacatcgaagaactc
ggacgcaccctcggtgaagaacttctcgagccaacccgcatctacgccaaggactgcctg
gcactgatcgcagagtgcgaagttcacaccttctgccacgtcaccggcggcggcctcgca
ggcaacctcgagcgggttatcccagaaggactcgtcgcagaaatgtcccgagcaacttgg
accccaggccaaatcttccgcaccatctcctctgtgggcaaggtttcccgcgaagaaatg
gaaaagaccttcaacatgggtgtcggcatggttgcagtcgttgctgaaaaggaccgcgac
cgcgccctggcaatgctcaccgcacgtcacattgactgctgggaaatcggaaccgtacgt
aacggtgaagagggagagcctcgcgtgatcctcaacggcgagcaccctggctactaa

DBGET integrated database retrieval system