KEGG   Corynebacterium glutamicum R: cgR_2494Help
Entry
cgR_2494          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cgt00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cgt00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2752303..2752782)
Genome map
AA seq 159 aa AA seqDB search
MTSIHDISVTLNDGTETTMADWAGHLLLIVNVASKCGLTPQYEGLQKLYEEYQDRGFFVI
GVPCNQFNGQEPGTDAEVCAFAQNQYDVTFPLLSKTEVNGEGTHPLYKVLKEATGGSEIE
WNFEKFLVDAEGNTIKRFAPRTEPSAAEVVEAIEENLPI
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgacttctattcatgacatcagcgtaaccctcaatgacggcacagaaaccaccatggcg
gattgggcgggccaccttttgctcatcgtgaacgtggcatccaagtgcggactcacgcca
cagtatgaagggcttcaaaaactgtatgaggaataccaagatcgaggcttctttgtcatt
ggcgtgccttgtaatcaattcaacggccaggaacctggaactgatgctgaagtgtgtgct
ttcgcgcaaaatcagtacgacgtcaccttcccgctcttgagcaaaaccgaggtgaatggg
gagggtacccaccccctgtacaaggtgctcaaagaggcaactggtggtagtgaaatcgag
tggaattttgagaaattcctggtagatgcagaaggtaacacgattaagcgctttgctcct
cggacggaaccatctgcagctgaggtagtggaagcaatcgaggagaatctccctatctaa

DBGET integrated database retrieval system