KEGG   Corynebacterium glutamicum R: cgR_2494Help
Entry
cgR_2494          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    cgR_2494
  Metabolism of other amino acids
   00480 Glutathione metabolism
    cgR_2494
Enzymes [BR:cgt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     cgR_2494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2752303..2752782)
Genome map
AA seq 159 aa AA seqDB search
MTSIHDISVTLNDGTETTMADWAGHLLLIVNVASKCGLTPQYEGLQKLYEEYQDRGFFVI
GVPCNQFNGQEPGTDAEVCAFAQNQYDVTFPLLSKTEVNGEGTHPLYKVLKEATGGSEIE
WNFEKFLVDAEGNTIKRFAPRTEPSAAEVVEAIEENLPI
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgacttctattcatgacatcagcgtaaccctcaatgacggcacagaaaccaccatggcg
gattgggcgggccaccttttgctcatcgtgaacgtggcatccaagtgcggactcacgcca
cagtatgaagggcttcaaaaactgtatgaggaataccaagatcgaggcttctttgtcatt
ggcgtgccttgtaatcaattcaacggccaggaacctggaactgatgctgaagtgtgtgct
ttcgcgcaaaatcagtacgacgtcaccttcccgctcttgagcaaaaccgaggtgaatggg
gagggtacccaccccctgtacaaggtgctcaaagaggcaactggtggtagtgaaatcgag
tggaattttgagaaattcctggtagatgcagaaggtaacacgattaagcgctttgctcct
cggacggaaccatctgcagctgaggtagtggaagcaatcgaggagaatctccctatctaa

DBGET integrated database retrieval system