KEGG   Corynebacterium glutamicum R: cgR_2595Help
Entry
cgR_2595          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00790  Folate biosynthesis
cgt01100  Metabolic pathways
Module
cgt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cgR_2595
Enzymes [BR:cgt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     cgR_2595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: BAF55609
UniProt: A4QH93
Position
complement(2865781..2866635)
Genome map
AA seq 284 aa AA seqDB search
MNVSSLTIPGRCLVMGIVNVTEDSFSDGGKYIDVDQAIAHAKELVAAGADMIDVGGESTR
PGAVRVDASVERDRVVPVIKALHDAGIHTSVDTMRASVAQAAAGAGVSMINDVSGGLADP
EMFSVMAEAQIPVCLMHWRTLQFGDAAGQADHGGDVVADVHAVLDDLVARATAAGVAENQ
IVLDPGLGFAKSREDNWRLLQALPEFISGPFPILVGASRKRFLAGVRKDRGLDVTPIDAD
PATAAVTAVSAHMGAWGVRVHDVPVSRDAVDVAALWRSGGTHHG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtatcctctttgaccatcccgggacgctgtttggtcatgggaattgtcaatgtc
actgaggattccttttcggacggtggcaagtacattgacgttgatcaggcgatcgcgcat
gccaaggaattggtggctgctggcgccgacatgattgatgtcggcggcgagtccacccgg
cctggggcagtgcgcgtcgacgcgtccgtggaacgggaccgggttgtgccggtcattaag
gcgcttcacgacgccggcatccacacttccgtagacaccatgcgggcctccgtggcgcag
gctgccgcgggcgctggcgtctccatgatcaacgacgtctctggcggtttggctgatcct
gagatgttttctgtcatggcggaagcgcaaattcccgtctgtttgatgcactggcgcacc
ctccaattcggtgatgccgcaggtcaggcagatcacggtggagacgttgtagccgatgtg
cacgcagtgcttgatgatcttgtcgcccgcgccaccgctgctggtgtggccgaaaaccag
atcgtgcttgatccaggtttgggttttgccaaatcacgtgaagacaactggcgtttgctg
caagcactgcccgagtttatttctggacctttccccatcctggtgggagcatcccggaag
cgattcctggctggcgtgcgcaaagaccgtggcctagatgtcacccccattgatgccgac
ccagcaaccgcagcggtgaccgcagtttctgcacatatgggagcatggggtgtgcgcgtg
cacgatgtcccagtatcaagggacgctgttgatgttgccgcattgtggcgaagtggagga
actcaccatggctga

DBGET integrated database retrieval system