KEGG   Corynebacterium glutamicum R: cgR_2695Help
Entry
cgR_2695          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00010  Glycolysis / Gluconeogenesis
cgt00071  Fatty acid degradation
cgt00350  Tyrosine metabolism
cgt00625  Chloroalkane and chloroalkene degradation
cgt00626  Naphthalene degradation
cgt01100  Metabolic pathways
cgt01110  Biosynthesis of secondary metabolites
cgt01120  Microbial metabolism in diverse environments
cgt01130  Biosynthesis of antibiotics
cgt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgR_2695
  Lipid metabolism
   00071 Fatty acid degradation
    cgR_2695
  Amino acid metabolism
   00350 Tyrosine metabolism
    cgR_2695
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    cgR_2695
   00626 Naphthalene degradation
    cgR_2695
Enzymes [BR:cgt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     cgR_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 adh_short TrkA_N ThiF 3HCDH_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BAF55711
UniProt: A4QHJ5
Position
complement(2983188..2984225)
Genome map
AA seq 345 aa AA seqDB search
MTTAAPQEFTAAVVEKFGHEVTVKDIDLPKPGPNQALVKVLTSGICHTDLHALEGDWPVK
PEPPFVPGHEGVGEVVELGPGEHDVKVGDIVGNAWLWSACGTCEYCITGRETQCNEAEYG
GYTQNGSFGQYMLVDTRYAARIPDGVDYLEAAPILCAGVTVYKALKVSETRPGQFMVISG
VGGLGHIAVQYAAAMGMRVIAVDIADDKLELARKHGAEFTVNARNEDPGEAVQKYTNGGA
HGVLVTAVHEAAFGQALDMARRAGTIVFNGLPPGEFPASVFNIVFKGLTIRGSLVGTRQD
LAEALDFFARGLIKPTVSECSLDEVNDVLDRMRNGKIDGRVAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgctgcaccccaagaatttactgctgctgttgttgaaaaattcggtcatgag
gtgaccgtgaaggatattgaccttccaaagccaggaccaaaccaggcattggtgaaggta
ctcacctccggcatctgccacaccgacctccacgccttggagggcgattggccagtaaag
ccggaaccaccattcgtaccaggacacgaaggtgtaggtgaagttgttgagctcggacca
ggtgaacacgatgtgaaggtcggcgatattgtcggcaatgcatggctctggtcagcgtgt
ggcacctgcgaatactgcatcaccggcagggaaactcagtgcaacgaagctgagtatggt
ggctacacccaaaatggatccttcggccagtacatgctggtggatacccgttacgccgct
cgcatcccagacggcgtggactacctcgaagcagcaccaattctgtgtgcaggcgtgact
gtctacaaggcactcaaagtctctgaaacccgcccgggccaattcatggtgatctccggt
gtcggcggacttggccacatcgcagtccaatacgcagcggcgatgggcatgcgtgtcatt
gcggtagatattgccgatgacaagctggaacttgcccgtaagcacggtgcggaatttacc
gtgaatgctcgcaatgaagatccaggcgaagctgtacagaagtacaccaacggtggcgca
cacggcgtgcttgtgactgcagttcacgaggcagcattcggccaggcgctggatatggct
cgacgtgcaggaacgattgtgttcaacggcctgccaccgggagagttcccagcatccgtg
ttcaacatcgtattcaagggcctgaccatccgtggatccctcgtgggaacccgccaagac
ttggccgaagcgctcgatttctttgcacgcggactaatcaagccaaccgtgagtgagtgt
tccctcgatgaggtcaatgatgttcttgaccgcatgcgaaacggcaagattgatggtcgt
gtggcaattcgctactaa

DBGET integrated database retrieval system