KEGG   Corynebacterium glutamicum R: cgR_2695Help
Entry
cgR_2695          CDS       T00501                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    cgR_2695
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgR_2695
  Lipid metabolism
   00071 Fatty acid degradation
    cgR_2695
  Amino acid metabolism
   00350 Tyrosine metabolism
    cgR_2695
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    cgR_2695
   00626 Naphthalene degradation
    cgR_2695
Enzymes [BR:cgt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     cgR_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2983188..2984225)
Genome map
AA seq 345 aa AA seqDB search
MTTAAPQEFTAAVVEKFGHEVTVKDIDLPKPGPNQALVKVLTSGICHTDLHALEGDWPVK
PEPPFVPGHEGVGEVVELGPGEHDVKVGDIVGNAWLWSACGTCEYCITGRETQCNEAEYG
GYTQNGSFGQYMLVDTRYAARIPDGVDYLEAAPILCAGVTVYKALKVSETRPGQFMVISG
VGGLGHIAVQYAAAMGMRVIAVDIADDKLELARKHGAEFTVNARNEDPGEAVQKYTNGGA
HGVLVTAVHEAAFGQALDMARRAGTIVFNGLPPGEFPASVFNIVFKGLTIRGSLVGTRQD
LAEALDFFARGLIKPTVSECSLDEVNDVLDRMRNGKIDGRVAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgctgcaccccaagaatttactgctgctgttgttgaaaaattcggtcatgag
gtgaccgtgaaggatattgaccttccaaagccaggaccaaaccaggcattggtgaaggta
ctcacctccggcatctgccacaccgacctccacgccttggagggcgattggccagtaaag
ccggaaccaccattcgtaccaggacacgaaggtgtaggtgaagttgttgagctcggacca
ggtgaacacgatgtgaaggtcggcgatattgtcggcaatgcatggctctggtcagcgtgt
ggcacctgcgaatactgcatcaccggcagggaaactcagtgcaacgaagctgagtatggt
ggctacacccaaaatggatccttcggccagtacatgctggtggatacccgttacgccgct
cgcatcccagacggcgtggactacctcgaagcagcaccaattctgtgtgcaggcgtgact
gtctacaaggcactcaaagtctctgaaacccgcccgggccaattcatggtgatctccggt
gtcggcggacttggccacatcgcagtccaatacgcagcggcgatgggcatgcgtgtcatt
gcggtagatattgccgatgacaagctggaacttgcccgtaagcacggtgcggaatttacc
gtgaatgctcgcaatgaagatccaggcgaagctgtacagaagtacaccaacggtggcgca
cacggcgtgcttgtgactgcagttcacgaggcagcattcggccaggcgctggatatggct
cgacgtgcaggaacgattgtgttcaacggcctgccaccgggagagttcccagcatccgtg
ttcaacatcgtattcaagggcctgaccatccgtggatccctcgtgggaacccgccaagac
ttggccgaagcgctcgatttctttgcacgcggactaatcaagccaaccgtgagtgagtgt
tccctcgatgaggtcaatgatgttcttgaccgcatgcgaaacggcaagattgatggtcgt
gtggcaattcgctactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system