KEGG   Corynebacterium glutamicum R: cgR_2728Help
Entry
cgR_2728          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgR_2728
Enzymes [BR:cgt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     cgR_2728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3018453..3019862)
Genome map
AA seq 469 aa AA seqDB search
MTTFPQGFLWGGATAANQIEGAYNEGGKGLSIQDVMPGGAIKPSTEGPTEDNLKLKAIDF
YNNYVEDIALFAEMGFKTFRISIAWSRIFPNGDEQEPNEEGLAFYDRVFDELEKHGIEPL
VTLSHYETPLGLARKYGGWRSRELIEFFAHYARTVFNRYKGRVHYWLTFNEINAVLAMPF
TAGGIEVPRSELSESELYQAIHHELVASALVTKIAHEIDPNNQVGCMIIAVPRYGITPDP
RDQLTAQQKSHEDFAFGDIHVRGEYPGYLLREFREKGITIDITDEDREILKNTVDFVSFS
YYMSVCEAHDPENYASGGGNIIGGVTNPTLEASEWGWQVDPIGLRIVLNNYWERWQKPLF
IVENGLGAKDVLIDGPSGPTVDDDYRIKYLNDHLVQVGEAIEDGVNLLGYTTWGPIDLVS
ASTAQMSKRYGFIYVDRNDDGSGTLKRYKKKSFDWYRDVIATNGGSLQA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaccacattcccgcaaggtttcctctggggcggcgcgaccgcagccaaccaaatcgaa
ggtgcatacaacgaaggcggcaagggtctgtcgatccaggacgtcatgccgggcggtgcg
attaagccgtcaacggaaggccccaccgaggacaaccttaagctcaaggccattgatttc
tacaacaactacgtcgaagacatcgcactcttcgcggagatgggtttcaagactttccgt
atctccatcgcttggtcccgtattttccccaacggtgatgagcaggagccaaacgaagag
ggcttggcgttctacgaccgcgtattcgatgagctggaaaagcacggtattgagccacta
gttactcttagccactacgaaactccgctgggtttggctcgtaaatatggtggatggcgc
agccgtgagctcattgaattcttcgctcattacgcccgcactgtatttaaccgatacaag
ggacgtgtgcattactggctgaccttcaacgagatcaatgctgttctggcgatgcctttc
accgcgggtggaattgaagttccacgctctgagctgagtgaatctgagctctaccaagcc
attcaccatgagttggtggcgagcgcgttggtcaccaagattgcccatgagatcgatccg
aacaaccaggtcggctgcatgattattgcagttccgcgttatggaatcactcctgatcca
cgcgatcagctcaccgcgcagcagaagtcgcatgaggattttgctttcggcgatattcac
gtccgcggcgaatacccaggctacttgctgcgtgaattccgcgaaaagggcatcaccatc
gacatcacggatgaagatcgtgagatcctcaagaacaccgtcgacttcgtgtccttctcc
tattacatgtcggtctgtgaagcccacgatccggaaaactacgcatctggtggcggcaac
atcatcggcggtgtcaccaacccaaccctcgaggcatccgagtggggctggcaagttgac
ccaatcggcctgcgcatcgtcctcaacaactactgggagcgctggcaaaaaccactgttt
atcgtcgaaaacggactaggagcaaaggacgtgcttatcgacggaccctccggcccaaca
gtcgatgacgactaccgcatcaagtacctcaacgatcacctcgtgcaggtcggcgaagca
atcgaagatggcgtcaacctgctgggctacaccacttggggtcccattgacttggtctct
gcctccacagctcaaatgtccaagcgctatggtttcatttatgtagaccgcaacgatgat
ggctccggcaccttgaagcgctacaagaaaaagtccttcgactggtaccgcgatgtcatc
gcaaccaacggtggaagcctgcaggcttaa

DBGET integrated database retrieval system