KEGG   Corynebacterium glutamicum R: cgR_2734Help
Entry
cgR_2734          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00220  Arginine biosynthesis
cgt00250  Alanine, aspartate and glutamate metabolism
cgt00290  Valine, leucine and isoleucine biosynthesis
cgt01100  Metabolic pathways
cgt01110  Biosynthesis of secondary metabolites
cgt01130  Biosynthesis of antibiotics
cgt01210  2-Oxocarboxylic acid metabolism
cgt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    cgR_2734
   00290 Valine, leucine and isoleucine biosynthesis
    cgR_2734
   00220 Arginine biosynthesis
    cgR_2734
Enzymes [BR:cgt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     cgR_2734
    2.6.1.66  valine---pyruvate transaminase
     cgR_2734
Amino acid related enzymes [BR:cgt01007]
 Aminotransferase (transaminase)
  Class I
   cgR_2734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Strep_his_triad Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAF55751
UniProt: A4QHN5
Position
3026095..3027408
Genome map
AA seq 437 aa AA seqDB search
MTTDKRKTSKTTDTANKAVGADQAARPTRRTTRRIFDQSEKMKDVLYEIRGPVAAEAERM
ELDGHNILKLNTGNPAVFGFDAPDVIMRDMIANLPTSQGYSTSKGIIPARRAVVTRYEVV
PGFPHFDVDDVFLGNGVSELITMTTQALLNDGDEVLIPAPDYPLWTAATSLAGGKPVHYL
CDEEDDWNPSIEDIKSKISDKTKAIVVINPNNPTGAVYPRRVLEQIVEIAREHDLLILAD
EIYDRILYDDAEHISLATLAPDLLCITYNGLSKAYRVAGYRAGWMVLTGPKQYARGFIEG
LELLAGTRLCPNVPAQHAIQVALGGRQSIYDLTGEHGRLLEQRNMAWTKLNEIPGVSCVK
PMGALYAFPKLDPNVYEIHDDTQLMLDLLRAEKILMVQGTGFNWPHHDHFRVVTLPWASQ
LENAIERLGNFLSTYKQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgactacagacaagcgcaaaacctctaagaccaccgacaccgccaacaaggctgtgggc
gcggatcaggcggcgcgtcccactcggcgaacaactcgccgcatcttcgatcagtcggag
aagatgaaggacgtgctgtacgagatccgtggcccggtggccgcggaggcggaacgcatg
gagctcgacggacacaacatcctgaagctcaacactggaaacccagctgtattcggattc
gatgcacctgacgtgatcatgcgagacatgatcgcaaacctcccaacttcccaaggttat
tccacctcaaagggcatcattccagcccgccgagcagtggtaacccgctacgaagttgtg
cccggattcccccacttcgatgttgatgatgtgttcttaggcaacggtgtctcagaacta
atcaccatgaccacccaagcactcctcaacgacggcgatgaagttcttatcccagcaccg
gactacccactgtggactgccgcaacctccctggctggtggtaagcctgtgcactacctc
tgtgatgaggaagatgactggaacccatccatcgaagacatcaagtccaaaatctcagac
aaaaccaaagctattgtggtgatcaaccccaacaaccccacgggagctgtctacccgcgc
cgggtgttggaacaaatcgtcgagattgcacgcgagcatgacctgctgattttagccgat
gaaatctacgaccgcatcctctacgatgatgccgagcacatcagcctggcaacccttgca
ccagatctcctttgcatcacatacaacggtctatccaaggcataccgcgtcgcaggatac
cgagctggctggatggtattgactggaccaaagcaatacgcacgtggatttattgagggc
ctcgaactcctcgcaggcactcgactctgcccgaatgtcccagctcagcacgctattcag
gtggctctcggtggacgccagtccatttacgacctcactggtgaacacggccgactcctg
gaacagcgcaacatggcatggacgaaactcaacgaaatcccaggtgtcagctgtgtgaaa
ccaatgggtgctttgtacgcgttccccaagcttgacccgaacgtgtacgaaatccacgac
gacacccaactcatgctggatcttctccgtgccgagaaaatcctcatggttcagggcact
ggcttcaactggccacatcacgatcacttccgagtggtcaccctgccatgggcatcgcaa
ttagaaaacgcaattgagcgcctaggaaacttcctgtccacctacaagcagtag

DBGET integrated database retrieval system