KEGG   Corynebacterium glutamicum R: cgR_2740Help
Entry
cgR_2740          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cgt  Corynebacterium glutamicum R
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cgt00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cgt00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3034540..3035685)
Genome map
AA seq 381 aa AA seqDB search
MKPLAAAVAVAGVLLAGCAEEPEQQKAISRLSTSTSTPPAPTAEDLARAQIPEQQRDQVA
SLMMVGVANYDQALDALNQGVGGIFIGSWTDENLLTEPGRNIEALREAVGRDFSVSIDFE
GGRVQRATNILGDFPSPRVMAQTMTPEQVEDLAEILGTGLAAHGVTVNFAPVVDVDAWGL
PVVGDRSFSNDPAVAATYATAFAKGLSKVGITPVFKHFPGHGRASGDSHTQDVVTPALDE
LKTYDLIPYGQALSETDGAVMVGHMIVPGLGTDGVPSSIDPATYQLLRSGDYPGGVPFDG
VIYTDDLSGMSAISATHSPAEAVLASLKAGADQALWIDYGSLVPAIDLVDAAVSSGEYPQ
EQMLASALRVQLLYITRLEQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacccctcgcagcagccgtcgcggtagccggtgtgctccttgcgggctgcgcagaa
gagccggaacagcaaaaagcaataagccgcttatcgacgtccacctccacccctcccgca
ccgaccgcggaggatttggcgcgcgcgcaaatccctgagcagcaacgcgaccaagtcgcg
tcgctgatgatggttggagttgcgaattatgatcaggcattggatgcgctcaatcagggg
gtgggtggcatctttattggttcctggacagatgaaaatctgctcacggaacctggccgt
aatattgaggcgctccgcgaagccgtcggcagggatttttccgtcagcatcgacttcgaa
ggcggccgtgtccagcgtgccaccaatattttgggtgatttcccctcaccgcgcgtgatg
gcgcaaaccatgacgccggaacaagtagaagatctcgcagaaatcctaggcactggttta
gctgcacatggtgtgacagttaactttgcacctgttgtagatgtagatgcttggggcctc
cccgtcgttggcgatcgttccttttccaacgacccagccgtagcagctacttatgccaca
gcttttgcaaagggcttaagcaaagtaggaattaccccagtattcaaacatttcccaggt
cacggtcgtgcaagtggtgattcgcacacccaagatgtggtgacccccgcacttgatgag
cttaaaacttacgacctcatcccttatggccaagcactttctgaaaccgatggcgccgtc
atggtgggccacatgatcgtcccaggccttggcaccgacggcgttccatcttccatcgac
cctgccacctatcaactgctgcgcagtggcgattacccaggtggagtgcctttcgatggc
gtgatctacaccgatgacctctccggaatgagcgctatctctgccacccattcacccgca
gaagcagtgctggcctcccttaaagcaggcgccgaccaagcattgtggatcgactacggt
tcccttgttcctgcaattgatctcgtcgatgctgctgtcagcagcggtgaataccctcaa
gaacaaatgctggcatctgcgttaagagtccaattgctctacatcacacgtctcgaacaa
aagtga

DBGET integrated database retrieval system