KEGG   Corynebacterium glutamicum R: cgR_2778Help
Entry
cgR_2778          CDS       T00501                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cgt00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3084518..3086047)
Genome map
AA seq 509 aa AA seqDB search
MRISKANAYVAAIDQGTTSTRCIFIDAQGKVVSSASKEHRQIFPQQGWVEHDPEEIWDNI
RSVVSQAMVSIDITPHEVASLGVTNQRETTVVWDKHTGEPVYNAIVWQDTRTSDICLEIA
GEEGQEKWLDRTGLLINSYPSGPKIKWILDNVEGARERAEKGDLLFGTMDTWVLWNLTGG
VRGDDGDDAIHVTDVTNASRTLLMDLRTQQWDPELCEALDIPMSMLPEIRPSVGEFRSVR
HRGTLADVPITGVLGDQQAALFGQGGFHEGAAKNTYGTGLFLLMNTGTSLKISEHGLLST
IAYQREGSAPVYALEGSVSMGGSLVQWLRDNLQLIPNAPAIENLAREVEDNGGVHVVPAF
TGLFAPRWRPDARGVITGLTRFANRKHIARAVLEANAFQTREVVDAMAKDAGKALESLRV
DGAMVENDLLMQMQADFLGIDVQRLEDVETTAVGVAFAAGLGSGFFKTTDEIEKLIAVKK
VWNPDMSEEERERRYAEWNRAVEHSYDQA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgagaatctcaaaggccaatgcgtatgttgcagcgattgaccaaggcaccacttccact
cggtgcatcttcattgatgcccaaggaaaagtggtgtcttctgcttctaaggagcaccgc
caaatcttcccacaacagggctgggtagagcacgatcctgaagaaatttgggacaacatc
cgatctgtcgtcagccaggcgatggtctccattgacatcaccccacacgaggttgcatcg
ctgggagtcaccaaccagcgcgaaaccaccgtggtgtgggacaagcacaccggcgaacct
gtctacaacgcaatcgtgtggcaagacacccgcacctctgacatttgcctagagatcgcg
ggcgaagaaggccaagaaaagtggcttgaccgcaccggcctgctgatcaactcctaccca
tcggggcccaaaatcaagtggattcttgacaacgttgagggagctcgcgaacgcgccgaa
aagggcgaccttttgtttggcaccatggatacctgggtgctgtggaacctgaccggcggt
gtccgcggcgacgacggtgatgatgccatccacgtcaccgatgtcaccaacgcatcccgc
acactattgatggatctccgcacacaacagtgggatccagaactatgcgaagccctagac
attccgatgtccatgctccctgagattcgtccctccgtcggagaattccgctccgtgcgc
caccgcggaaccctagccgacgtccccattactggcgtgctcggcgaccagcaagcggcc
ctttttggtcagggcggattccacgaaggtgctgctaaaaatacctacggcaccggcctc
ttcctgctgatgaacaccggcacctcgttgaagatttccgagcacggcctgctgtccacc
atcgcctatcaacgggaaggatccgctccggtctacgcgctggaaggttccgtatccatg
ggcggttccttggtgcagtggctgcgcgacaacctacagctaatccccaacgcaccagcg
attgaaaacctcgcccgagaagtcgaagacaacggcggcgttcatgttgtcccagcattc
accggactgttcgcaccacgttggcgccccgatgctcgtggcgtcattacaggcctcacc
cgttttgccaaccgcaaacacatcgcccgcgcagtccttgaagccaacgccttccaaacc
cgcgaagttgtggacgccatggccaaagacgcaggcaaagccctcgaatccctccgcgtc
gacggtgcgatggtggaaaatgacctcctcatgcaaatgcaagccgacttcctcggcatc
gacgtccaacgtctcgaggacgtagaaaccaccgccgtcggcgtcgcattcgctgcaggt
ctcggctctggattcttcaaaacaactgacgagatcgaaaaacttatcgcagtgaagaaa
gtctggaaccctgacatgagcgaagaagagcgcgaacgtcgctatgccgaatggaatagg
gcagtggagcattcttatgaccaggcctag

DBGET integrated database retrieval system