KEGG   Corynebacterium glutamicum R: cgR_2889Help
Entry
cgR_2889          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    cgR_2889
Enzymes [BR:cgt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     cgR_2889
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     cgR_2889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3205159..3205968
Genome map
AA seq 269 aa AA seqDB search
MPEGHVIHRLAGELTKHFGETVLDATSPQGRFASEAAIINGHRIAVAEAYGKHLFVEFDA
DHPEHILYIHLGLIGTLQFEPAEETRGQIRLHLSDGEIAANLRGPQWCRLITDAERTQAI
GKLGADPIRDDADPEPIRIKVQRSGRSIGSLLMDQKLFAGVGNIYRAETLFRLGISPFTI
GKDITTAQFRSIWADLVGLMKDGVVAGRIDTVRPEHTPEAMGRPPRKDDHGGEVYTYRRT
GQECFLCETPIKEQVMEGRNLFWCPGCQR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaggacacgtgattcatcgactagctggggagctcaccaagcattttggcgaa
accgttttggacgccacttcacctcaagggcgctttgcttctgaagcggcgatcatcaac
ggtcaccgcatcgcggttgcggaggcctacggcaagcacctgttcgtcgagttcgatgca
gatcaccctgagcacatcttgtatatccatttgggcctgattggcacgttacagtttgag
cctgcagaagaaacccgtgggcagattcgcctgcacctttccgatggggagatcgccgct
aatttgcgcggaccccaatggtgcaggttgatcaccgatgcagagcgcacccaggccatt
ggaaaattgggcgctgatccgattcgcgatgatgccgatccggaaccaattcggattaag
gtgcagcgctcagggcgaagcattggttcgttgttgatggatcagaagcttttcgcaggt
gtgggaaatatttaccgtgcggagacacttttccgcctggggatttcaccgttcaccatt
ggaaaagacatcaccacggcacagttccgatccatttgggcggatcttgttgggttgatg
aaagacggtgttgtggctggtcggattgatactgtgcgcccggaacacacaccggaggcg
atgggtaggccaccgcggaaagatgatcacggcggtgaggtttacacctatcggcgaacc
ggtcaagagtgctttctgtgcgaaactcccatcaaggagcaggttatggagggtcgcaac
ttattttggtgtcccggctgccaacgctag

DBGET integrated database retrieval system