KEGG   Corynebacterium glutamicum R: cgR_2920Help
Entry
cgR_2920          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00260  Glycine, serine and threonine metabolism
cgt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cgt01100  Metabolic pathways
cgt01110  Biosynthesis of secondary metabolites
cgt01130  Biosynthesis of antibiotics
cgt01230  Biosynthesis of amino acids
Module
cgt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cgR_2920
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cgR_2920
Enzymes [BR:cgt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cgR_2920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP SpoU_methylase
Motif
Other DBs
NCBI-ProteinID: BAF55942
UniProt: A4QI76
Position
3241055..3242308
Genome map
AA seq 417 aa AA seqDB search
MTEKENLGGSTLLPAYFGEFGGQFVAESLLPALDQLEKAFVDATNSPEFREELGGYLRDY
LGRPTPLTECSNLPLSGEGKGFARIFLKREDLVHGGAHKTNQVIGQVLLAKRMGKTRIIA
ETGAGQHGTATALACALMGLECVVYMGAKDVARQQPNVYRMQLHGAKVIPVESGSGTLKD
AVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHKVISEEAKAQMLERTGKLPDVVV
ACVGGGSNAIGMFADFIDDEGVELVGAEPAGEGLDSGKHGATITNGQIGILHGTRSYLMR
NSDGQVEESYSISAGLDYPGVGPQHAHLHATGRATYVGITDAEALQAFQYLARYEGIIPA
LESSHAFAYALKRAKTAEEEGQNLTILVSLSGRGDKDVDHVRRTLEENPELILKDNR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaagaaaacttgggtggctccacgctgctgcctgcatacttcggtgaattc
ggcggccagttcgtcgcggaatccctcctgcctgctctcgaccagctggagaaggccttc
gttgacgcgaccaacagcccagagttccgcgaagaactcggcggctacctccgcgattac
ctcggccgcccaaccccgctgaccgaatgctccaacctgccactctcaggcgaaggcaaa
ggctttgcgcggatcttcctcaagcgcgaagacctcgtccacggcggtgcacacaaaact
aaccaggtgatcggccaggtgctgcttgccaagcgcatgggcaaaacccgcatcatcgca
gagaccggcgcaggccagcacggcaccgccaccgctctcgcatgtgcgctcatgggcctc
gagtgcgttgtctacatgggcgccaaggacgttgcccgccagcagcccaacgtctaccgc
atgcagctgcacggcgcgaaggtcatccccgtggaatctggttccggcaccctgaaggac
gccgtgaatgaagcgctgcgcgattggaccgcaaccttccacgagtcccactaccttctc
ggcaccgccgccggcccgcatccattcccaaccatcgtgcgtgaattccacaaggtgatc
tctgaggaagccaaggcacagatgctagagcgcaccggcaagcttcccgacgttgtggtc
gcctgtgtcggtggtggctccaacgccatcggcatgttcgcagacttcattgacgatgaa
ggcgtagagctcgtcggcgctgagccagccggtgaaggcctcgactccggcaagcacggc
gcaaccatcaccaacggtcagatcggcatcctacacggcacccgttcctacctgatgcgc
aactccgacggccaagtggaagagtcctactccatctccgccggacttgattacccaggc
gtcggcccacagcacgcacacctgcacgccaccggccgcgccacctacgttggtatcacc
gacgccgaagccctccaagcattccagtatctcgcccgctacgaaggcatcatccccgca
ctggaatcctcacacgcattcgcctacgcactcaagcgcgccaagaccgccgaagaggaa
ggccagaacttaaccatcctcgtctccctatccggccgtggcgacaaggacgttgaccac
gtgcgccgcaccctcgaagaaaatccagaactgatcctgaaggacaaccgatga

DBGET integrated database retrieval system