KEGG   Corynebacterium glutamicum K051: WA5_1993Help
Entry
WA5_1993          CDS       T02508                                 

Gene name
MutM1
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cgu  Corynebacterium glutamicum K051
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cgu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2188309..2189169)
Genome map
AA seq 286 aa AA seqDB search
MPELPEVEVVRRGLEDHMVGHTIVSATVLHPRAARNQLGGGPEIEANIAGLRVSAAKRRG
KFLWLELIDAPSGETRPDLGLLVHLGMSGQMLIKEPDAPISPHLRAKVELDNGDEVWFVD
QRTFGYWWLGDLVDGVPERVSHIATDVLDESADFSAIARNLKSRKSEIKRLLLNQEIVSG
IGNIYADEMLWQAKIHPLQRADRLSLARLEELLQAGKDVMTKALAQGGTSFDALYVNVNG
NSGYFALSLNAYAQTGEPCGRCGTLIIRESFMNRGSHYCPNCQKRR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaactgcctgaagttgaggtggtgcgccgcggtttagaagatcatatggtcggc
cacaccatcgtgtccgccacagtgcttcacccgcgcgcagcccgcaatcaactcggcggt
ggccccgaaatcgaggccaacatcgcagggcttagggtcagcgctgccaagcgacgcggc
aaattcctctggcttgagcttatcgacgcaccctccggcgaaacccgtcccgatttaggg
ctactggttcaccttgggatgagtggacaaatgctcatcaaagaaccagatgcaccaatt
agtccacaccttcgagccaaagtcgagctagataatggcgatgaagtgtggtttgtcgat
caacgcaccttcggttattggtggctcggcgacctagttgatggagtacccgaacgcgtc
tctcacattgccacagatgtattggatgagtctgctgatttctctgcgattgcgcggaat
ttgaaatctcggaaatcggagatcaaacgcctcctgcttaaccaagagatcgtctccggc
atcggaaatatctatgccgatgaaatgctctggcaagcaaaaattcacccattgcaacgt
gccgatcgactgtccctagctcgcttggaagaacttcttcaagctggcaaagacgtgatg
accaaagcacttgctcaaggtggcacctctttcgacgcgctctatgtcaacgtcaatggc
aactccggctactttgcgctgtcattgaatgcttatgcgcaaaccggggagccgtgcgga
cgctgcggaacattaatcatccgggagagtttcatgaaccgcggctcccactactgccca
aactgccagaagcggcgctag

DBGET integrated database retrieval system