KEGG   Corynebacterium glutamicum K051: WA5_2217Help
Entry
WA5_2217          CDS       T02508                                 

Gene name
MalQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cgu  Corynebacterium glutamicum K051
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    WA5_2217 (MalQ)
Enzymes [BR:cgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     WA5_2217 (MalQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2430296..2432416
Genome map
AA seq 706 aa AA seqDB search
MTARRFLNELADLYGVATSYTDYKGAHIEVSDDTLVKILRALGVNLDTSNLPNDDAIQRQ
IALFHDREFTRPLPPSVVAVEGDELVFPVHVHDGSPADVHIELEDGTQRDVSQVENWTAP
REIDGIRWGEASFKIPGDLPLGWHKLHLKSNERSAECGLIITPARLSTADKYLDSPRSGV
MAQIYSVRSTLSWGMGDFNDLGNLASVVAQDGADFLLINPMHAAEPLPPTEDSPYLPTTR
RFINPIYIRVEDIPEFNQLEIDLRDDIAEMAAEFRERNLTSDIIERNDVYAAKLQVLRAI
FEMPRSSEREANFVSFVQREGQGLIDFATWCADRETAQSESVHGTEPDRDELTMFYMWLQ
WLCDEQLAAAQKRAVDAGMSIGIMADLAVGVHPGGADAQNLSHVLAPDASVGAPPDGYNQ
QGQDWSQPPWHPVRLAEEGYIPWRNLLRTVLRHSGGIRVDHVLGLFRLFVMPRMQSPATG
TYIRFDHNALVGILALEAELAGAVVIGEDLGTFEPWVQDALAQRGIMGTSILWFEHSPSQ
PGPRRQEEYRPLALTTVTTHDLPPTAGYLEGEHIALRERLGVLNTDPAAELAEDLQWQAE
ILDVAASANALPAREYVGLERDQRGELAELLEGLHTFVAKTPSALTCVCLVDMVGEKRAQ
NQPGTTRDMYPNWCIPLCDSEGNSVLIESLRENELYHRVAKASKRD
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctcgcagatttttgaatgaactcgccgatctctacggcgtagcaacttcctac
actgattacaaaggtgcccatattgaggtcagcgatgacacattagtgaaaatcctgcgt
gctctgggtgtgaatttagatacaagcaacctccccaacgatgacgctatccaacgccaa
attgccctcttccatgatcgagagttcactcgcccactgcctccatcggtggttgcagtt
gaaggtgatgaactagttttcccggtgcatgtgcacgacggttcccctgcagatgtccac
atcgaattggaagacggcacgcagcgggatgtttctcaggtggaaaactggacagcgcca
cgggaaattgatgggattaggtggggcgaggcatcgtttaagattcctggtgatctcccc
ttgggttggcacaagcttcaccttaaatccaatgaacgctcagctgagtgcggtttgatc
atcaccccggctcgtctgtctactgctgataagtatcttgattcccctcgcagtggtgtc
atggcgcagatctactctgtgcgttccacgttgtcgtggggcatgggtgatttcaatgat
ttaggaaacttggcaagtgtggttgcccaggatggagcagacttcctgctcatcaacccc
atgcacgctgcagagccgctgcctcctactgaggactctccttatctgcccacaaccagg
cgctttatcaacccgatctacattcgggtagaagatattccggagtttaatcagcttgag
attgatctacgcgatgatatcgcagagatggctgcggaattccgcgaacgcaatctgacc
tcagacatcattgagcgcaatgacgtctacgctgcaaagcttcaagtgctgcgcgccatt
tttgaaatgcctcgttccagcgaacgtgaagccaactttgtctccttcgtgcaacgggaa
ggccaaggtcttattgatttcgccacctggtgcgcggaccgcgaaactgcacagtctgaa
tctgtccacggaactgagccagaccgcgatgagctgaccatgttctacatgtggttgcag
tggctatgtgatgagcagctggcggcagctcaaaagcgcgctgtcgatgccggaatgtcg
atcggcatcatggcagacctggcagttggtgtgcatccaggtggtgctgatgcccagaac
ctcagccacgtacttgctccggatgcgtcagtgggcgccccaccagatggatacaaccag
cagggccaagactggtcccagccaccatggcatccagtgcgtcttgcagaggaaggctac
attccgtggcgtaatctgctgcgcactgtgctgcgtcactccggcggaatccgcgtggac
cacgttcttggtttgttcaggctctttgtcatgccacgcatgcaatcccctgctacgggc
acctatatccgcttcgaccataatgcgttggtaggcattctagccctagaagcagaactc
gcaggcgccgttgtcattggtgaagatctgggaacgtttgagccttgggtacaagatgca
ttggctcagcgtggcatcatgggcacctcgatcctatggttcgagcattccccaagccag
ccgggtcctcgccgccaggaagagtatcgtccgctggccttgaccactgtgaccactcat
gatctccctccgactgctggttatttggagggcgagcacattgctcttcgtgagcgattg
ggggtgctcaacactgatcctgctgcagaactcgctgaggatctgcagtggcaagcggag
atccttgatgtcgcagcatctgccaacgcattgccagcccgggaatacgtgggactcgaa
cgcgatcagcgcggtgagttggctgagctgttggaaggcctgcacactttcgttgcgaaa
accccttcagcactgacctgtgtctgcttggtagacatggtcggtgaaaagcgggcacag
aatcagccgggcacaacgagggatatgtatcccaactggtgtatcccactgtgtgacagc
gaaggcaactccgtgctcattgaatcgctgcgtgaaaatgagctgtatcaccgtgtggca
aaggcaagcaagcgagattag

DBGET integrated database retrieval system