KEGG   Corynebacterium glutamicum K051: WA5_2274Help
Entry
WA5_2274          CDS       T02508                                 

Gene name
ProB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cgu  Corynebacterium glutamicum K051
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cgu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cgu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2496667..2497776)
Genome map
AA seq 369 aa AA seqDB search
MRERISNAKRVVVKIGSSSLTNDEDGHTVDPNRINTIVNALQARMEAGSDLIVVSSGAVA
AGMAPLGLSTRPTELAVKQAAAAVGQVHLMHQWGRSFARYGRPIGQVLLTAADAGKRDRA
RNAQRTIDKLRILGAVPIVNENDTVATTGVNFGDNDRLAAIVAHLVSADALVLLSDVDGL
FDKNPTDPTAKFISEVRDGNDLKGVIAGDGGKVGTGGMASKVSAARLASRSGVPVLLTSA
ANIGPALEDAQVGTVFHPKDNRLSAWKFWALYAADTAGKIRLDDGAVEAVTSGGKSLLAV
GITEIIGDFQQGEIVEILGPAGQIIGRGEVSYDSDTLQSMVGMQTQDLPDGMQRPVVHAD
YLSNYASRA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagcgcatctccaacgctaagcgagtggtggtgaaaattggttcgtcctcattg
actaacgatgaggacggacacaccgtcgatcccaaccgcatcaacactattgtcaatgcc
ttgcaagcacgcatggaagctggctcggacctcatcgttgtgtcctctggcgcagtggcc
gcgggaatggccccgcttggattgagcacccggcccacggaattggcagtcaagcaggct
gcagcagcagtggggcaagttcacctcatgcaccagtggggacgttcttttgcccggtat
ggtcgccccatcggccaggtgcttcttaccgcagctgatgcaggaaagcgtgatcgtgcg
aggaatgcgcagcgtaccatcgacaagctgcgcattttgggcgcggttcctatcgtcaat
gaaaatgacaccgtggcaaccaccggtgtgaattttggtgacaacgaccgacttgctgca
attgtggcgcacctggtgtcggctgatgctttggtgctgctcagtgacgtggatggactt
tttgataaaaaccctactgatcccaccgcgaagtttatttccgaggttcgtgacggcaat
gatttgaaaggtgtcattgccggcgacggcggaaaagtgggcaccggtggcatggcatca
aaggtgtctgctgcacgtttggcttcccgaagtggcgtgcctgtgctgttgacctctgcg
gcaaacattggcccagcactggaagacgcccaggtgggcactgtattccaccccaaggac
aaccgcctctccgcgtggaagttctgggctttgtatgccgcagatactgcaggaaagatc
cgactcgatgacggcgcggtggaagcagtgacctccggtggtaaatctttgctggctgtg
ggcattactgaaatcattggtgatttccagcagggtgagatcgtggagatcttgggacct
gccggccaaatcatcgggcgaggcgaggtgtcctacgattctgataccttgcaatcaatg
gttggtatgcaaacgcaggaccttccagatggcatgcagcgcccggtagtgcatgcagat
tatctgtccaactacgccagccgcgcgtaa

DBGET integrated database retrieval system