KEGG   Corynebacterium glutamicum K051: WA5_2274Help
Entry
WA5_2274          CDS       T02508                                 

Gene name
ProB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cgu  Corynebacterium glutamicum K051
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cgu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    WA5_2274 (ProB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    WA5_2274 (ProB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    WA5_2274 (ProB)
Enzymes [BR:cgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     WA5_2274 (ProB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2496667..2497776)
Genome map
AA seq 369 aa AA seqDB search
MRERISNAKRVVVKIGSSSLTNDEDGHTVDPNRINTIVNALQARMEAGSDLIVVSSGAVA
AGMAPLGLSTRPTELAVKQAAAAVGQVHLMHQWGRSFARYGRPIGQVLLTAADAGKRDRA
RNAQRTIDKLRILGAVPIVNENDTVATTGVNFGDNDRLAAIVAHLVSADALVLLSDVDGL
FDKNPTDPTAKFISEVRDGNDLKGVIAGDGGKVGTGGMASKVSAARLASRSGVPVLLTSA
ANIGPALEDAQVGTVFHPKDNRLSAWKFWALYAADTAGKIRLDDGAVEAVTSGGKSLLAV
GITEIIGDFQQGEIVEILGPAGQIIGRGEVSYDSDTLQSMVGMQTQDLPDGMQRPVVHAD
YLSNYASRA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagcgcatctccaacgctaagcgagtggtggtgaaaattggttcgtcctcattg
actaacgatgaggacggacacaccgtcgatcccaaccgcatcaacactattgtcaatgcc
ttgcaagcacgcatggaagctggctcggacctcatcgttgtgtcctctggcgcagtggcc
gcgggaatggccccgcttggattgagcacccggcccacggaattggcagtcaagcaggct
gcagcagcagtggggcaagttcacctcatgcaccagtggggacgttcttttgcccggtat
ggtcgccccatcggccaggtgcttcttaccgcagctgatgcaggaaagcgtgatcgtgcg
aggaatgcgcagcgtaccatcgacaagctgcgcattttgggcgcggttcctatcgtcaat
gaaaatgacaccgtggcaaccaccggtgtgaattttggtgacaacgaccgacttgctgca
attgtggcgcacctggtgtcggctgatgctttggtgctgctcagtgacgtggatggactt
tttgataaaaaccctactgatcccaccgcgaagtttatttccgaggttcgtgacggcaat
gatttgaaaggtgtcattgccggcgacggcggaaaagtgggcaccggtggcatggcatca
aaggtgtctgctgcacgtttggcttcccgaagtggcgtgcctgtgctgttgacctctgcg
gcaaacattggcccagcactggaagacgcccaggtgggcactgtattccaccccaaggac
aaccgcctctccgcgtggaagttctgggctttgtatgccgcagatactgcaggaaagatc
cgactcgatgacggcgcggtggaagcagtgacctccggtggtaaatctttgctggctgtg
ggcattactgaaatcattggtgatttccagcagggtgagatcgtggagatcttgggacct
gccggccaaatcatcgggcgaggcgaggtgtcctacgattctgataccttgcaatcaatg
gttggtatgcaaacgcaggaccttccagatggcatgcagcgcccggtagtgcatgcagat
tatctgtccaactacgccagccgcgcgtaa

DBGET integrated database retrieval system