KEGG   Corynebacterium glutamicum K051: WA5_2309Help
Entry
WA5_2309          CDS       T02508                                 

Gene name
PcaF
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgu  Corynebacterium glutamicum K051
Pathway
cgu00071  Fatty acid degradation
cgu00072  Synthesis and degradation of ketone bodies
cgu00280  Valine, leucine and isoleucine degradation
cgu00310  Lysine degradation
cgu00362  Benzoate degradation
cgu00380  Tryptophan metabolism
cgu00620  Pyruvate metabolism
cgu00630  Glyoxylate and dicarboxylate metabolism
cgu00640  Propanoate metabolism
cgu00650  Butanoate metabolism
cgu00900  Terpenoid backbone biosynthesis
cgu01100  Metabolic pathways
cgu01110  Biosynthesis of secondary metabolites
cgu01120  Microbial metabolism in diverse environments
cgu01130  Biosynthesis of antibiotics
cgu01200  Carbon metabolism
cgu01212  Fatty acid metabolism
cgu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    WA5_2309 (PcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    WA5_2309 (PcaF)
   00640 Propanoate metabolism
    WA5_2309 (PcaF)
   00650 Butanoate metabolism
    WA5_2309 (PcaF)
  Lipid metabolism
   00071 Fatty acid degradation
    WA5_2309 (PcaF)
   00072 Synthesis and degradation of ketone bodies
    WA5_2309 (PcaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WA5_2309 (PcaF)
   00310 Lysine degradation
    WA5_2309 (PcaF)
   00380 Tryptophan metabolism
    WA5_2309 (PcaF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WA5_2309 (PcaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WA5_2309 (PcaF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    WA5_2309 (PcaF)
Enzymes [BR:cgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WA5_2309 (PcaF)
Exosome [BR:cgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WA5_2309 (PcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CCH25529
Position
2534201..2535427
Genome map
AA seq 408 aa AA seqDB search
MNPQDIVICSPLRTPVGAYGGSFTGVPVEELATTVINAIVEATGITGDDVDDLILGQASP
NGAAPALGRVVALDSKLGQNVPGMQLDRRCGSGLQAIVTAAAHVASGAADLIIAGGAESM
SRVEYTVSGDIRWGVKGGDMQLRDRLAEARETAGGRNHPIPGGMIETAENLRREYGISRE
EQDKISAASQQRWGKAADAGLFDDEIVPVTVPAKKRGQEPTIVSRDEHGRPGTTVEKLAA
LRPIMGRQDAEATVTAGNASGQNDGAAAVIVTTRAKAEEKGLRPVMRLAGWSVAAVPPET
MGIGPVPATKKVLDRLGLTLEDIGAIELNEAFAAQALSVLKEWNISWEDERVNPLGSGIS
MGHPVGATGARMAVTLAHRMQRENTQYGLATMCIGGGQGLAAVFEKEN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcaagatattgtcatctgttccccattgcgcaccccagttggtgcttacggc
ggatccttcaccggcgtccctgttgaagaattggccaccaccgtgatcaacgcgatcgtt
gaggcaaccggcatcaccggcgacgatgtggacgatctgatcctcggccaggcatccccc
aacggtgcggctccagcactgggccgtgttgttgctctagattccaagcttggccaaaac
gttccaggcatgcagcttgatcgccgctgtggttccggcctgcaggcaatcgtcaccgct
gctgcacacgttgcatccggcgctgctgatctgatcatcgcaggtggcgcagaatccatg
agccgcgttgagtacaccgtgtccggcgatatccgttggggtgtcaagggcggcgacatg
cagcttcgtgaccgccttgcagaagcacgcgaaaccgctggcggacgcaaccacccgatc
cctggtggcatgatcgagaccgctgagaacctgcgtcgcgaatacggcatctcccgcgag
gagcaggacaagatctccgcagcgtcccagcagcgttggggcaaggctgctgatgcgggg
cttttcgacgacgagatcgtgccagtcaccgtccctgccaagaagcgcggccaggagcca
accatcgtttctcgagacgagcatggtcgaccaggaacaaccgtcgaaaagcttgctgct
ttgcgccccatcatgggccgccaggatgcggaagcaaccgtcaccgctggcaacgcgtcc
ggccaaaatgatggcgctgctgccgtcatcgtgaccactcgcgccaaggccgaggagaag
ggcctgcgcccagtcatgcgtttggctggctggtctgtggctgctgttcccccagagacc
atgggtattggacctgttcctgccaccaagaaggtcctggatcgtttgggccttaccctg
gaggacatcggcgcgatcgaactcaacgaagctttcgcagctcaggcactgtctgtgctg
aaggaatggaacatttcttgggaagatgagcgcgtcaacccactgggttccggtatttcc
atgggacacccagtcggtgccaccggtgctcgcatggcagtaaccttggctcaccgcatg
cagcgtgaaaacactcagtacggactggccaccatgtgcatcggtggcggccagggtctt
gcagctgtctttgaaaaggagaactaa

DBGET integrated database retrieval system