KEGG   Corynebacterium glyciniphilum: CGLY_11550Help
Entry
CGLY_11550        CDS       T03073                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgy  Corynebacterium glyciniphilum
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cgy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGLY_11550 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    CGLY_11550 (phbA)
   00640 Propanoate metabolism
    CGLY_11550 (phbA)
   00650 Butanoate metabolism
    CGLY_11550 (phbA)
  Lipid metabolism
   00071 Fatty acid degradation
    CGLY_11550 (phbA)
   00072 Synthesis and degradation of ketone bodies
    CGLY_11550 (phbA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CGLY_11550 (phbA)
   00310 Lysine degradation
    CGLY_11550 (phbA)
   00380 Tryptophan metabolism
    CGLY_11550 (phbA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CGLY_11550 (phbA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CGLY_11550 (phbA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CGLY_11550 (phbA)
Enzymes [BR:cgy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CGLY_11550 (phbA)
Exosome [BR:cgy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGLY_11550 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2501304..2502590
Genome map
AA seq 428 aa AA seqDB search
MNDTPTSTPTTAPAPTDVVLCSPLRTPVGAYGGAFTDVPVQELASTVVSAIVERTGLTAD
SIDDIILGQASPDGAAPALGRVVALDSGLGDSVPGMQLDRRCGSGLQAVVTAAAHVATGA
ADLIIAGGAESMSRTGYSVDGSIRWGVKGGDLVLHDRLAEGRASAGGRHHPIPGGMIETA
ENLRREYGITREAQDALAAESHRRAVAAIDDGLFADEIVPVTVPGKRRRDPETVVDRDEH
PRPGTTTEKLAGLRPVMGRQDDEATVTAGNASGQNDGAAAMVVTTRARAEELGLEPFARL
SGWAVAGVAPETMGIGPVPATARVLDRLGITLDDLDVIELNEAFAAQALSVLQEWGVPAD
DPRLNPHGSGISLGHPVGATGARMLVTLCHELRRRGKDGDGTDGLRGLATMCIGGGQGLA
AVLEAEQA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaccccaacctccacccccaccactgctcccgcgccgaccgacgtggtgctg
tgctcgccgttgcgcaccccggtcggcgcctacggaggagctttcaccgacgtgcccgtc
caggagctggcctccaccgtcgtcagcgctatcgtcgagcgcaccggcctgacagctgac
tccatcgacgacatcatcctcggccaggcctccccggatggtgccgcgcccgctctcgga
cgcgtcgtcgcactggactccggcctaggtgacagcgtgccgggcatgcagctcgaccga
cggtgcggctccgggctgcaggcggtggtcaccgccgccgcccacgtcgccacgggtgcc
gccgacctgatcatcgccggcggcgcggaatcgatgagccgcaccggatactccgtcgac
ggctccatccgctggggtgtcaaaggtggcgacctcgtcctccacgaccgtctggccgaa
ggacgtgcctctgccggaggtcgccaccaccccatccccggcggaatgatcgagaccgcc
gagaacctgcgccgcgagtacggcatcacccgcgaggctcaggatgcactggccgccgaa
tcccaccgacgagccgtcgcggccatcgatgacggtctgttcgccgacgagatcgtccct
gtgacggttccgggcaagcgccgtcgtgatccggagaccgtcgtcgaccgcgacgagcac
ccgcgcccgggcaccaccacggagaagctcgccggcctgcggccggtgatgggacgccag
gacgacgaggccaccgtcaccgccggcaacgcctccggccagaatgacggggccgccgcc
atggtcgtcaccacccgggctcgcgccgaagaactcgggttggaacctttcgcccgactg
agcggctgggccgtggccggagtcgccccggagaccatggggatcggaccggtcccggcg
accgcgcgggtcctcgaccgcctcggaataaccctggacgacctcgacgtcatcgaactc
aacgaggccttcgccgcccaggccctgtccgtgctgcaggagtggggtgttcctgccgac
gatccccggctgaacccgcacggttccggaatctccctgggccaccctgtcggtgccacc
ggcgcccggatgctggtgacactctgccacgagctacgtcgtcgcggtaaggatggtgat
ggtacggacggtctgcgtggactggccacgatgtgtatcggtggaggacagggactggcc
gccgtactcgaagcagaacaagcctga

DBGET integrated database retrieval system