KEGG   Campylobacter hominis ATCC BAA-381: CHAB381_0041Help
Entry
CHAB381_0041      CDS       T00577                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cha  Campylobacter hominis ATCC BAA-381
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cha00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
37787..38371
Genome map
AA seq 194 aa AA seqDB search
MDEQSKIEIEKHMQEILRLIGENPERDGLVKTPERVAKSLEFLTSGYRMEPKNVLNDALF
SSTNNEMVLMKNIEFYSLCEHHLLPIIGRVHVAYIPNKKVVGLSKIPRMVNIFARRLQIQ
EQMTEQIANAIQEVVHPLGVGVVVEARHMCVEMRGVEKINSITTTSALRGSFITRADTRK
EFFDLINSPKNFAF
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacaatcaaaaatagaaattgaaaaacatatgcaagaaattttaagattaatc
ggtgaaaatcctgagcgcgacggacttgtaaaaacgcctgagcgcgttgcgaaatctttg
gaatttttaacaagcggctatagaatggaaccgaaaaatgtcttaaatgacgcacttttt
tccagcacaaacaacgaaatggtacttatgaaaaatattgagttttatagtctttgcgag
caccatttattaccgattatagggcgcgttcacgtggcttacataccgaataaaaaagtt
gtcgggcttagtaaaattccgcgtatggtaaatattttcgcgcgcagacttcaaatccaa
gagcaaatgacggaacaaatcgcaaatgcgattcaagaagttgtgcatcctttgggtgtc
ggagtggttgtagaagcgcgtcatatgtgcgttgaaatgaggggtgtcgaaaagatcaat
tccattaccacaacttcggctttaagaggaagttttataacaagagccgataccagaaaa
gagttttttgacttaatcaattcacctaagaattttgctttttaa

DBGET integrated database retrieval system