KEGG   Campylobacter hominis: CHAB381_0041Help
Entry
CHAB381_0041      CDS       T00577                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cha  Campylobacter hominis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CHAB381_0041 (folE)
Enzymes [BR:cha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CHAB381_0041 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
37787..38371
Genome map
AA seq 194 aa AA seqDB search
MDEQSKIEIEKHMQEILRLIGENPERDGLVKTPERVAKSLEFLTSGYRMEPKNVLNDALF
SSTNNEMVLMKNIEFYSLCEHHLLPIIGRVHVAYIPNKKVVGLSKIPRMVNIFARRLQIQ
EQMTEQIANAIQEVVHPLGVGVVVEARHMCVEMRGVEKINSITTTSALRGSFITRADTRK
EFFDLINSPKNFAF
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacaatcaaaaatagaaattgaaaaacatatgcaagaaattttaagattaatc
ggtgaaaatcctgagcgcgacggacttgtaaaaacgcctgagcgcgttgcgaaatctttg
gaatttttaacaagcggctatagaatggaaccgaaaaatgtcttaaatgacgcacttttt
tccagcacaaacaacgaaatggtacttatgaaaaatattgagttttatagtctttgcgag
caccatttattaccgattatagggcgcgttcacgtggcttacataccgaataaaaaagtt
gtcgggcttagtaaaattccgcgtatggtaaatattttcgcgcgcagacttcaaatccaa
gagcaaatgacggaacaaatcgcaaatgcgattcaagaagttgtgcatcctttgggtgtc
ggagtggttgtagaagcgcgtcatatgtgcgttgaaatgaggggtgtcgaaaagatcaat
tccattaccacaacttcggctttaagaggaagttttataacaagagccgataccagaaaa
gagttttttgacttaatcaattcacctaagaattttgctttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system