KEGG   Campylobacter hominis: CHAB381_0121Help
Entry
CHAB381_0121      CDS       T00577                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cha  Campylobacter hominis
Pathway
cha00900  Terpenoid backbone biosynthesis
cha01100  Metabolic pathways
cha01110  Biosynthesis of secondary metabolites
cha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CHAB381_0121 (dxr)
Enzymes [BR:cha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CHAB381_0121 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: ABS51413
UniProt: A7HZP3
Position
complement(102876..103955)
Genome map
AA seq 359 aa AA seqDB search
MVVLGSTGSIGTNSLEIARKFNIEVEALACAENVKKLNAQIAEFHPKFVYIKDEKLKSKV
AHNKIFSGENGICEMLNRCESKTVINALVGFAGLIPSLKIQNSGKILCLSNKESLVVGGK
FLDTSKIRAIDSEHFGLKFLLENSAKPAKMIITASGGAFYKTPIKDLSSKKAADALKHPN
WNMGAKITIDSATMANKLFEMLEAFWLYGCKNLDALIEPSSSVHALIEFIDGSTAAHLSR
TDMKLAIAHAILPNLKSEILKPVDLLSLNLKFEKIDIKKYPIFELKDEVLSNPDLGVIIN
AANEIAVFAFLQGKCGFLDISSTIFKAVEKFNDLTPENAEDLIKIDKIVRNFARSELRL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtagttttaggatccaccggaagtataggcacaaactcccttgaaatagcacgaaaa
tttaacattgaagtagaagctttagcgtgcgctgaaaatgtaaaaaaattaaacgcgcaa
attgcggaatttcatccgaaatttgtctacataaaagatgaaaaattaaaatcaaaagta
gcacacaataaaatttttagcggcgaaaacggcatttgcgaaatgctgaatcgctgcgaa
agtaaaaccgtaataaatgcattagtcggctttgcaggacttatcccgagtctgaaaatt
caaaattcaggcaaaattttatgcctttcaaataaagaaagtttggtagtgggcggaaaa
tttttggatacttctaaaattcgtgcaatagacagcgaacatttcggtcttaaattttta
cttgaaaatagcgcaaaacccgctaaaatgataattacagcaagcggaggcgcgttttat
aaaacgccgattaaagatttaagctcaaaaaaagccgctgacgctctaaaacatccgaac
tggaatatgggcgcaaaaatcacaatcgatagcgctacaatggcaaacaaactttttgaa
atgctggaagctttttggctttacggctgcaaaaatctggacgctttaattgaaccaagc
tcaagcgtacatgctttgatagaatttattgacggctcgacagccgctcatttaagccgc
acggatatgaaactggcaatcgctcatgcgattttgcctaatttaaaaagcgaaatttta
aaacctgtcgatttgttaagtttaaatttgaaatttgaaaagatagatattaaaaaatat
cctattttcgaacttaaagatgaagttttgtcaaatcctgatttgggcgttataataaat
gcggcaaacgaaattgcagtttttgcgtttttgcaaggaaagtgcggatttttagatatt
tcatctacaatttttaaagccgtagaaaaatttaacgatttgacgccggaaaatgcggaa
gatcttataaaaatagataaaattgtgcgaaatttcgcaagaagcgagcttagattatga

DBGET integrated database retrieval system