KEGG   Campylobacter hominis ATCC BAA-381: CHAB381_0126Help
Entry
CHAB381_0126      CDS       T00577                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
cha  Campylobacter hominis ATCC BAA-381
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cha00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:cha00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:cha00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
107936..108904
Genome map
AA seq 322 aa AA seqDB search
MRKIFILAIFCAGIFAFDETEIYQKAQDYENKGDYENAMKLYKQIAQNRFQKPKNVEIST
QISNDSKISVDKALPQNSYKILSKDDVEHKSESKYAQDDKLFDISVYEPFYFLGSYDFSD
KDGRKNGEVKFGFGLEMPIVYDLFGLNEKIAFAYTQRAWWQVDLDSAPFRETNYQPEIFI
QIPFENSIKYVQLGALHESNGKDGELSRSWNKLYAQAAFKMSNFTFTPRVWRAFLTDDNN
DISDYMGYGEFNFNYEIGEHELHAKWRNNLKFDENRGAIELGWFFPLYGNFKGYVQYFSG
YGESLVDYSKSVDKISFGFAYK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatttttatcttggctattttttgcgccggaatttttgctttcgatgaaact
gaaatttatcaaaaagcgcaagattatgaaaataaaggtgattatgaaaatgcgatgaaa
ttgtataagcaaatcgcacaaaatagatttcaaaaaccgaaaaatgtcgaaatttctacg
caaatttccaatgatagtaaaatttcagtcgataaagctttgcctcaaaattcatacaaa
attctaagcaaagacgatgtggagcacaaaagcgaatcaaaatatgcacaagatgataaa
ttatttgatataagcgtttacgaacctttttattttttgggaagctatgatttcagcgat
aaagatgggcgtaaaaacggcgaagttaagttcggtttcggtttggaaatgccgattgtt
tatgatttattcgggcttaatgaaaaaatcgcatttgcttacacgcaaagggcgtggtgg
caagtcgatcttgatagtgcgccgtttcgtgagacaaattatcaacctgaaatttttata
caaattccttttgaaaatagtataaaatacgtgcaattaggcgctttgcacgaatcaaac
ggaaaagatggagaacttagccgtagttggaataaattatatgctcaagccgcatttaaa
atgtcaaattttacatttacgccgagagtttggcgggcatttttaacggatgacaacaac
gatataagcgattatatgggctatggcgagtttaatttcaactatgaaattggtgaacac
gaacttcatgcaaaatggcgaaataatttaaaatttgatgaaaatcgcggcgcaatcgag
cttggatggttttttccgctttatggaaatttcaaaggatacgtgcagtacttttcagga
tatggcgaaagcttagtcgattattcaaaaagtgtagataaaataagttttggttttgca
tataaatag

DBGET integrated database retrieval system