KEGG   Campylobacter hominis: CHAB381_0126Help
Entry
CHAB381_0126      CDS       T00577                                 

Definition
(GenBank) phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
cha  Campylobacter hominis
Pathway
cha00564  Glycerophospholipid metabolism
cha00565  Ether lipid metabolism
cha00592  alpha-Linolenic acid metabolism
cha01100  Metabolic pathways
cha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CHAB381_0126
   00565 Ether lipid metabolism
    CHAB381_0126
   00590 Arachidonic acid metabolism
    CHAB381_0126
   00591 Linoleic acid metabolism
    CHAB381_0126
   00592 alpha-Linolenic acid metabolism
    CHAB381_0126
Enzymes [BR:cha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     CHAB381_0126
    3.1.1.32  phospholipase A1
     CHAB381_0126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1 MIT TPR_2 TPR_7 ANAPC3 TPR_8 TPR_1
Motif
Other DBs
NCBI-ProteinID: ABS52347
UniProt: A7HZP8
Position
107936..108904
Genome map
AA seq 322 aa AA seqDB search
MRKIFILAIFCAGIFAFDETEIYQKAQDYENKGDYENAMKLYKQIAQNRFQKPKNVEIST
QISNDSKISVDKALPQNSYKILSKDDVEHKSESKYAQDDKLFDISVYEPFYFLGSYDFSD
KDGRKNGEVKFGFGLEMPIVYDLFGLNEKIAFAYTQRAWWQVDLDSAPFRETNYQPEIFI
QIPFENSIKYVQLGALHESNGKDGELSRSWNKLYAQAAFKMSNFTFTPRVWRAFLTDDNN
DISDYMGYGEFNFNYEIGEHELHAKWRNNLKFDENRGAIELGWFFPLYGNFKGYVQYFSG
YGESLVDYSKSVDKISFGFAYK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatttttatcttggctattttttgcgccggaatttttgctttcgatgaaact
gaaatttatcaaaaagcgcaagattatgaaaataaaggtgattatgaaaatgcgatgaaa
ttgtataagcaaatcgcacaaaatagatttcaaaaaccgaaaaatgtcgaaatttctacg
caaatttccaatgatagtaaaatttcagtcgataaagctttgcctcaaaattcatacaaa
attctaagcaaagacgatgtggagcacaaaagcgaatcaaaatatgcacaagatgataaa
ttatttgatataagcgtttacgaacctttttattttttgggaagctatgatttcagcgat
aaagatgggcgtaaaaacggcgaagttaagttcggtttcggtttggaaatgccgattgtt
tatgatttattcgggcttaatgaaaaaatcgcatttgcttacacgcaaagggcgtggtgg
caagtcgatcttgatagtgcgccgtttcgtgagacaaattatcaacctgaaatttttata
caaattccttttgaaaatagtataaaatacgtgcaattaggcgctttgcacgaatcaaac
ggaaaagatggagaacttagccgtagttggaataaattatatgctcaagccgcatttaaa
atgtcaaattttacatttacgccgagagtttggcgggcatttttaacggatgacaacaac
gatataagcgattatatgggctatggcgagtttaatttcaactatgaaattggtgaacac
gaacttcatgcaaaatggcgaaataatttaaaatttgatgaaaatcgcggcgcaatcgag
cttggatggttttttccgctttatggaaatttcaaaggatacgtgcagtacttttcagga
tatggcgaaagcttagtcgattattcaaaaagtgtagataaaataagttttggttttgca
tataaatag

DBGET integrated database retrieval system