KEGG   Campylobacter hominis ATCC BAA-381: CHAB381_0197Help
Entry
CHAB381_0197      CDS       T00577                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cha  Campylobacter hominis ATCC BAA-381
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cha00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cha00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
176413..177702
Genome map
AA seq 429 aa AA seqDB search
MKIKFQNTFITDNSNECQNGAYFMQIDANMKFADSALKNGAKIISIDEAKKMLNINKNIK
IVGITGTNGKTTTAAAIYSTLLDLGFKCGLSGTRGAFINDCRIDEKGLTTSSVFKTIGYL
YEASKEDCEFFIMEVSSHAIAQNRIQGLNFALKIFTNLTQDHLDYHKTMEEYARVKSSFF
KDDTPKLINKDAGGITYNETNARTYALKQIATYSVLAYSVKGAIDALLRTPDGEIQIESP
LVGEFNLYNLMAAFAAVKILTNYDNKKIAEALANFGGVEGRVQIVSRNPYVVVDFAHTPD
GIEKVLNALKDHELIAVFGAGGDRDKTKRPKMGAIVEHFAKTAIITSDNPRSEDPNVIID
EIESGMREKNKIIKIENRAEAIKKAISLAKNGEMVVILGKGDETYQEIKGVKHHFNDKEC
VLEILNGAK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaatttcaaaatacatttattaccgataattccaacgaatgccaaaatggc
gcatattttatgcaaatcgacgcaaatatgaaatttgcggacagtgcgttaaaaaatggt
gcaaaaatcataagtatagatgaagctaaaaaaatgcttaatataaataaaaatatcaaa
atcgtcggaatcactggcacaaacggcaaaaccacaaccgccgcggcaatttattccact
cttttggatttaggctttaaatgcggattatcgggcacaagaggcgcttttataaatgat
tgtagaattgatgaaaaaggtcttacaacaagttctgtttttaaaacaatcggttatttg
tatgaggcaagcaaagaagactgtgagttttttataatggaagtaagctctcacgcaatt
gcgcaaaaccgtatacaaggactgaattttgcacttaaaatttttacaaatctaacacag
gatcaccttgattatcacaaaactatggaagaatatgcacgcgtaaaaagctcatttttc
aaagacgatacgccgaaattgataaataaggacgcgggcggtatcacatacaatgaaaca
aatgcacgaacttacgcattaaaacagattgcaacttattctgttttagcttatagcgta
aaaggagcgattgacgctcttttaagaacaccggatggagaaattcaaattgaaagtccg
cttgtaggagagtttaatttatataatttaatggctgcgtttgcggctgttaaaattctt
acaaattatgataataaaaaaattgccgaagcacttgcaaattttggcggtgtggaaggt
cgtgtccaaattgtaagtcgcaatccttatgtagttgtagattttgctcatacgccggat
ggaattgaaaaagtattaaatgcgctaaaagatcacgaacttattgcagtttttggcgcc
ggcggagatagagataagacaaagcgtccaaaaatgggagcgatagtagagcatttcgca
aaaacggcaattattacaagtgataatccaagaagtgaagatccaaatgtcataatagat
gaaattgaaagcggtatgcgagaaaaaaacaaaataataaaaatagaaaatcgcgccgaa
gctataaaaaaagcgataagtcttgctaaaaacggcgaaatggttgtgattctcggtaaa
ggcgatgaaacttatcaggaaattaaaggtgtaaagcatcattttaacgataaagagtgc
gttcttgaaattttaaatggcgctaagtga

DBGET integrated database retrieval system