KEGG   Campylobacter hominis ATCC BAA-381: CHAB381_0240Help
Entry
CHAB381_0240      CDS       T00577                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cha  Campylobacter hominis ATCC BAA-381
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cha01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cha00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
220262..221365
Genome map
AA seq 367 aa AA seqDB search
MRHFDSMEILNELLKFQSITPDDDGAFNYISMILNDFEEINIDKNGVKNVIFRKTFGPGV
HICFAGHIDVVKPGIGWDSDPFDPLQKDGFIYARGAQDMKSAVASMICAVSGVQNFNGTI
SLLLTSDEEGDAVFGTREALKFLQSRGELPDFAVVGEPTCETVFGDTIKVGRRGSINGIL
RINGIQGHVAYPNKCVNPVHILASKFANFAGHDFDNGNDFFEPSKLVVVDIRGGMQVCNV
TPSDVSVMFNVRNSNLTDANDIKNFINDLYKDCDFDLNLKVSSNPFLTDKNSKIVQKLSQ
SVQKISGVCPVFTTGGGTSDARYFAEFNVDVAEFGVINDRLHAVNERVSVNEVQKLTEIY
KDLIENF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagacattttgacagtatggaaattttaaatgagcttttgaaatttcaatccattaca
cctgatgatgacggcgcttttaactatatttcaatgattttaaacgattttgaagaaatt
aatattgataaaaacggcgttaaaaacgtgatttttcgaaaaactttcggtcctggagtg
catatttgctttgcaggtcatattgacgtcgtaaaacccggaatcggttgggatagcgat
ccgtttgatcctttgcaaaaagacggttttatatatgcacgcggcgcacaagatatgaaa
agcgccgtagcttcgatgatttgtgcggtttccggggtgcaaaattttaatggcactatt
agtctgcttcttacaagcgacgaagaaggagatgctgtttttgggacgcgtgaagcttta
aaatttttacaatctcgaggtgaacttcctgattttgcggttgtcggagaacctacttgt
gaaaccgttttcggcgatacgataaaggtcggaagaagaggttctataaatgggatttta
cgaataaacggaattcaaggacacgtagcatatccaaataaatgcgtaaatccggtgcat
attttggcaagtaaatttgcaaattttgcaggacatgattttgataacggaaatgatttt
tttgaaccgagcaaacttgtggttgttgatatcaggggcggtatgcaggtatgcaatgta
acgccaagcgatgtcagtgttatgtttaatgtaagaaactcaaatttaacggatgcaaac
gatattaaaaattttataaacgatttgtataaagattgtgattttgatcttaatttaaaa
gttagctctaatccctttttgacggataaaaactcaaaaatcgtgcaaaagttaagccaa
agcgtgcaaaaaatttcaggtgtttgtcctgttttcactacaggcggcggcacaagtgat
gcaagatattttgccgagtttaatgtcgatgttgccgagttcggtgttataaacgacaga
ttgcacgctgtaaatgaacgggtaagtgtaaatgaagtgcaaaaattaactgaaatttat
aaagatttgattgaaaatttttaa

DBGET integrated database retrieval system