KEGG   Campylobacter hominis: CHAB381_0370Help
Entry
CHAB381_0370      CDS       T00577                                 

Definition
cytochrome c551 peroxidase (cytochrome cperoxidase) (CCP) (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cha  Campylobacter hominis
Brite
Enzymes [BR:cha01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CHAB381_0370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
337931..338971
Genome map
AA seq 346 aa AA seqDB search
MKITTIFLGSALVTSSLFAADNLAKAAKDAGLIALPTNQAALAKLAEETAIDAKDFPSTP
ERVELGKKLFFEPLLSKSGIISCNTCHNLARGGVDGIPASTGHKWTPNPHHVNAPTVYNS
VFNTVQFWDGRAAHLAAQAQGPMTADPEMASSPKLVEDRINSMPGYVEEFKKAWGDQKIT
FELITGTIGIFERTLNTPSRFDEFLAGKSDALNAEEKAGLKLFIDKGCTTCHIGINLGGT
MQPFEVVKKYKFANVGDFKGDANGLVKTPVLRNVELTAPYFHNGAIWKLTDAIKEMGSIQ
LGIDISDKDAKSIATFFKSLTGKMPEVVYPILPAQSESTPIPALDY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacaacgatttttttaggctcagctttagttacaagctctctttttgcggct
gataatttagctaaagcagctaaagacgcgggacttattgcacttcctacaaatcaagca
gctcttgctaaacttgcggaagagacagcaattgacgcaaaagattttccaagcacacct
gaaagagttgaacttggtaaaaaattattttttgaacctttgctttcaaaaagtggaatt
atatcatgtaatacctgtcacaatttagctcgtggcggtgtagatggaattcctgcttct
acaggccacaaatggacaccaaaccctcaccatgtaaatgcgcctaccgtttataactcg
gtattcaatactgttcaattttgggatggaagagctgctcaccttgcagcgcaagcacaa
ggtcctatgacagctgatcctgaaatggcttcgtctcctaaacttgttgaagatagaata
aactcaatgccgggatatgtagaagaatttaaaaaagcttggggcgatcaaaaaataaca
tttgaacttattacaggaacaattggaatttttgaaagaactttaaacactcctagcaga
tttgatgaatttttggcaggcaaatcagatgctttaaatgctgaggaaaaagcaggtcta
aaattatttatcgataagggctgtacaacttgccatatcggcataaatttaggcggaaca
atgcaaccgtttgaagttgttaaaaaatacaaattcgcgaatgtaggagatttcaaaggc
gatgcaaacggcttggttaaaactcctgttttaagaaacgtagaattgactgctccatat
ttccataacggtgctatttggaaattaacagatgcgataaaagaaatgggaagtattcaa
cttggtatagatatttctgataaagatgcaaaaagtatagctactttctttaaatctttg
acaggtaaaatgcctgaggttgtttatcctatacttcctgctcaaagtgaatctacgcca
attcctgcgcttgattactaa

DBGET integrated database retrieval system