KEGG   Campylobacter hominis: CHAB381_0418Help
Entry
CHAB381_0418      CDS       T00577                                 

Definition
(GenBank) phosphomannomutase/phosphoglucomutase (PMM/PGM)
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cha  Campylobacter hominis
Pathway
cha00010  Glycolysis / Gluconeogenesis
cha00030  Pentose phosphate pathway
cha00051  Fructose and mannose metabolism
cha00052  Galactose metabolism
cha00230  Purine metabolism
cha00500  Starch and sucrose metabolism
cha00520  Amino sugar and nucleotide sugar metabolism
cha01100  Metabolic pathways
cha01110  Biosynthesis of secondary metabolites
cha01120  Microbial metabolism in diverse environments
cha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHAB381_0418
   00030 Pentose phosphate pathway
    CHAB381_0418
   00051 Fructose and mannose metabolism
    CHAB381_0418
   00052 Galactose metabolism
    CHAB381_0418
   00500 Starch and sucrose metabolism
    CHAB381_0418
   00520 Amino sugar and nucleotide sugar metabolism
    CHAB381_0418
  Nucleotide metabolism
   00230 Purine metabolism
    CHAB381_0418
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CHAB381_0418
Enzymes [BR:cha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CHAB381_0418
    5.4.2.8  phosphomannomutase
     CHAB381_0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABS51678
UniProt: A7I0H5
Position
375437..376819
Genome map
AA seq 460 aa AA seqDB search
MIEQIFREYDIRGIFGEELTKNSVSAIGYILGLELKKRNLKSVSVGTDARVSKDALFSWL
AGGLKSAGCDVFDIGMLPTPVGYFSVFTHKFDANIMISGSHNPKEYNGFKITIGDDSFFG
EELKKFGKEVVEFLGNSKNFKKINFNVKCEKYDILTPYVGFFEKEFSHLKNFDFPFVCDF
ANGVGGITAERICKALNLNAKFMFETPDGNFPNHHPDPSEEKNLTDLKKVIRDENFALGF
GFDGDADRIAVLTKKHNFKGDELACLFALNMKNPKILGEVKCSSVMYDFIDKIGKSFMGK
TGHSNIKKAIKEHGYDLGAEVSGHIYFKERYFGFDDAIYAMVRVLELIQKGISLDDEIEK
LPKMYSTDEVKFHTTDEKKFSIIENVKNRVKNGVEGLPKIKEIITIDGIRIKFDHGWALV
RASNTTPVIVTRFEADSAAFRDLLQEKFMEILKKEENEGK
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacaaatttttagagaatacgatataagaggaatttttggcgaagagcttacc
aaaaacagcgtgagcgcgatcggttatatactcggtctggagctaaaaaaaagaaattta
aaaagtgtaagcgtaggaacggacgcaagagtcagtaaagacgcgcttttttcatggctt
gcaggcggtttaaaaagtgccggttgtgatgttttcgatatcggtatgcttcctacgccg
gttggatatttcagtgtttttacgcataaattcgacgcaaatataatgatttccggttca
cacaatccaaaagaatacaacggttttaaaatcacaataggcgatgacagtttttttggc
gaagagcttaaaaaattcggcaaagaagttgtagaatttttaggcaacagcaaaaatttt
aaaaaaataaattttaatgtaaaatgcgaaaaatacgatattttaacgccttatgtaggt
ttttttgaaaaagaattttctcatcttaaaaactttgattttccgtttgtttgcgacttt
gcaaacggggttggtggaattacggctgagcgaatttgcaaagcattaaacttaaatgca
aaatttatgtttgaaacacctgatggaaattttccaaatcatcatccggatccgagcgaa
gaaaaaaatttaacggatcttaaaaaagtgataagagatgaaaatttcgctcttggattc
ggttttgacggagatgctgacagaatcgccgttttgactaaaaaacacaattttaaaggc
gacgaacttgcctgcctttttgctttgaatatgaaaaatccgaaaattttaggcgaagtg
aaatgctcgtctgtaatgtatgattttatcgataaaatcggcaaaagttttatgggaaaa
acaggacattcgaatataaaaaaagctataaaagagcatggatacgatcttggagccgaa
gttagcgggcatatatattttaaagagagatatttcggatttgatgatgcgatttatgcg
atggtaagagtgcttgaacttattcaaaaaggcatttcacttgatgatgaaatagaaaaa
ttaccgaaaatgtatagcactgatgaagtgaaatttcacactaccgatgagaaaaaattc
tccatcatagaaaatgtcaaaaatcgcgtaaaaaacggtgtggaaggtttgccgaaaatc
aaggaaattattacaatagatggtattcgaataaaattcgatcacggttgggctcttgtc
agagcaagtaatacaacgcctgtaattgttaccagatttgaagccgatagtgcggctttt
agagatttactacaagaaaaatttatggaaattttaaaaaaggaagaaaatgaaggaaaa
tga

DBGET integrated database retrieval system