KEGG   Campylobacter hominis: CHAB381_0418Help
Entry
CHAB381_0418      CDS       T00577                                 

Definition
phosphomannomutase/phosphoglucomutase (PMM/PGM) (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cha  Campylobacter hominis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHAB381_0418
   00030 Pentose phosphate pathway
    CHAB381_0418
   00051 Fructose and mannose metabolism
    CHAB381_0418
   00052 Galactose metabolism
    CHAB381_0418
   00500 Starch and sucrose metabolism
    CHAB381_0418
   00520 Amino sugar and nucleotide sugar metabolism
    CHAB381_0418
  Nucleotide metabolism
   00230 Purine metabolism
    CHAB381_0418
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CHAB381_0418
Enzymes [BR:cha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CHAB381_0418
    5.4.2.8  phosphomannomutase
     CHAB381_0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375437..376819
Genome map
AA seq 460 aa AA seqDB search
MIEQIFREYDIRGIFGEELTKNSVSAIGYILGLELKKRNLKSVSVGTDARVSKDALFSWL
AGGLKSAGCDVFDIGMLPTPVGYFSVFTHKFDANIMISGSHNPKEYNGFKITIGDDSFFG
EELKKFGKEVVEFLGNSKNFKKINFNVKCEKYDILTPYVGFFEKEFSHLKNFDFPFVCDF
ANGVGGITAERICKALNLNAKFMFETPDGNFPNHHPDPSEEKNLTDLKKVIRDENFALGF
GFDGDADRIAVLTKKHNFKGDELACLFALNMKNPKILGEVKCSSVMYDFIDKIGKSFMGK
TGHSNIKKAIKEHGYDLGAEVSGHIYFKERYFGFDDAIYAMVRVLELIQKGISLDDEIEK
LPKMYSTDEVKFHTTDEKKFSIIENVKNRVKNGVEGLPKIKEIITIDGIRIKFDHGWALV
RASNTTPVIVTRFEADSAAFRDLLQEKFMEILKKEENEGK
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacaaatttttagagaatacgatataagaggaatttttggcgaagagcttacc
aaaaacagcgtgagcgcgatcggttatatactcggtctggagctaaaaaaaagaaattta
aaaagtgtaagcgtaggaacggacgcaagagtcagtaaagacgcgcttttttcatggctt
gcaggcggtttaaaaagtgccggttgtgatgttttcgatatcggtatgcttcctacgccg
gttggatatttcagtgtttttacgcataaattcgacgcaaatataatgatttccggttca
cacaatccaaaagaatacaacggttttaaaatcacaataggcgatgacagtttttttggc
gaagagcttaaaaaattcggcaaagaagttgtagaatttttaggcaacagcaaaaatttt
aaaaaaataaattttaatgtaaaatgcgaaaaatacgatattttaacgccttatgtaggt
ttttttgaaaaagaattttctcatcttaaaaactttgattttccgtttgtttgcgacttt
gcaaacggggttggtggaattacggctgagcgaatttgcaaagcattaaacttaaatgca
aaatttatgtttgaaacacctgatggaaattttccaaatcatcatccggatccgagcgaa
gaaaaaaatttaacggatcttaaaaaagtgataagagatgaaaatttcgctcttggattc
ggttttgacggagatgctgacagaatcgccgttttgactaaaaaacacaattttaaaggc
gacgaacttgcctgcctttttgctttgaatatgaaaaatccgaaaattttaggcgaagtg
aaatgctcgtctgtaatgtatgattttatcgataaaatcggcaaaagttttatgggaaaa
acaggacattcgaatataaaaaaagctataaaagagcatggatacgatcttggagccgaa
gttagcgggcatatatattttaaagagagatatttcggatttgatgatgcgatttatgcg
atggtaagagtgcttgaacttattcaaaaaggcatttcacttgatgatgaaatagaaaaa
ttaccgaaaatgtatagcactgatgaagtgaaatttcacactaccgatgagaaaaaattc
tccatcatagaaaatgtcaaaaatcgcgtaaaaaacggtgtggaaggtttgccgaaaatc
aaggaaattattacaatagatggtattcgaataaaattcgatcacggttgggctcttgtc
agagcaagtaatacaacgcctgtaattgttaccagatttgaagccgatagtgcggctttt
agagatttactacaagaaaaatttatggaaattttaaaaaaggaagaaaatgaaggaaaa
tga

DBGET integrated database retrieval system