KEGG   Campylobacter hominis: CHAB381_0523Help
Entry
CHAB381_0523      CDS       T00577                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cha  Campylobacter hominis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CHAB381_0523 (galU)
   00052 Galactose metabolism
    CHAB381_0523 (galU)
   00500 Starch and sucrose metabolism
    CHAB381_0523 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CHAB381_0523 (galU)
Enzymes [BR:cha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CHAB381_0523 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(478814..479644)
Genome map
AA seq 276 aa AA seqDB search
MIQTCLFPAAGYGTRFLPATKSLPKEMLPILTKPLIHYGVDEAMEAGMSNMAFVTGRGKR
ALEDYFDKSYELEDQISGSNKEKLLSEIRDLMKKCTFSFTRQESMKGLGNAIYTGRILTR
DEAFGVILADDLCVNENGEGILAQMVKIYEKYRCSIVAVMEVPKEKISSYGVVNGKFIED
NVMMINQMVEKPNPADAPSNLAIIGRYILTPDIFEILEQTKPGKNGEIQITDALMTQAKN
GIVIAYKFQGRRFDCGSLDGFVEATNYFYEKIHAKK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaacttgcttatttccagccgcaggttatggcacaagatttttacctgcaact
aaatctttacctaaagaaatgttgccgattcttacaaaaccgttaattcactacggtgtt
gatgaagcgatggaagcaggaatgagtaatatggcatttgttacagggcgtggaaagcgc
gcattggaagactattttgataaaagttatgaacttgaagatcaaatttcaggctcaaac
aaagagaaattattatcagaaattagagatctgatgaaaaaatgtacattttcttttact
cgtcaggagagtatgaaagggcttggaaatgctatttatactggtagaattttaacacgc
gacgaagctttcggtgtgattttagcggatgatttatgtgtaaatgaaaacggcgaaggg
atacttgctcaaatggtaaaaatttacgaaaaatatcgctgttccatagtagcggtaatg
gaagtgccgaaagaaaaaatttcaagttacggtgtagtaaatggaaaatttatcgaagat
aatgtgatgatgataaatcaaatggtggaaaaaccaaatcctgcagatgcaccgtcaaat
cttgcaataataggcagatatattttaactcctgatatttttgaaattttagagcaaaca
aagcctggaaaaaatggtgaaatacaaatcactgacgcgcttatgacacaagcaaaaaac
ggaattgtaatagcatataaatttcaaggtcgaagatttgattgcggaagtttagatggt
tttgtagaagctacaaactatttttatgagaaaattcatgctaaaaaatga

DBGET integrated database retrieval system