KEGG   Campylobacter hominis ATCC BAA-381: CHAB381_0573Help
Entry
CHAB381_0573      CDS       T00577                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cha  Campylobacter hominis ATCC BAA-381
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cha03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(523064..523618)
Genome map
AA seq 184 aa AA seqDB search
MIVAVEGIITKKEPTFCVLKTVTGVSYGISISLGCSARINKGEKIELLTAQILREDADLL
YGFLDEKEKRMFEMLIKLNGIGANTAMAVCSSLSSDNFLRAIINGDTATLTTVPGIGPKT
ARRIIAELSDAKIELANDGEQYKIETISALENLGFKRDKINKILLNCKSTNTADLIKEAL
KKLA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgcagtagaaggcataataacaaaaaaagaaccgactttttgcgtattaaaa
acagtaaccggagttagctatggaatcagcatttcgcttggatgttcggcacgaataaat
aaaggcgaaaaaatagaacttttaacagctcaaattttacgcgaagatgctgatttactt
tacggttttctagatgaaaaagaaaaaagaatgtttgaaatgctcataaaacttaacggt
atcggtgcgaatacggcgatggctgtttgttcaagtttaagcagcgataactttttgaga
gctattataaatggtgacaccgcaactcttacaacggttcctggaatcggaccaaaaacg
gctcgtagaataatagctgaattaagcgacgcaaaaatagagcttgcaaatgacggagaa
caatataaaattgaaactatcagcgcgcttgaaaatttaggatttaaaagagataaaatc
aataaaattttacttaattgcaaaagtacaaatacagccgatttaataaaagaggcactt
aaaaaattagcatag

DBGET integrated database retrieval system