KEGG   Campylobacter hominis: CHAB381_0819Help
Entry
CHAB381_0819      CDS       T00577                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cha  Campylobacter hominis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CHAB381_0819
Enzymes [BR:cha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CHAB381_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
756718..757287
Genome map
AA seq 189 aa AA seqDB search
MNIDYYAEKMQKISLSMFRKSFFGIFHGSISAKISDNQFLINKKNAIFDNFSKDDMVLLY
TKKDYRWNDASIDSDIHLNIYKTIKEAKCVCYAMPPQTVAYTLKHDFVIPKDYFGFAEFG
KVEIYDIKKFDDWYERAPSEISHYMFEENTDVMVIKGYGIYAYARNLGELAKKIAIIENS
CYILNLENF
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgattattacgcggaaaagatgcaaaaaatttctctttctatgtttagaaaa
agtttttttggtatttttcatggctctatttctgcaaaaatttcggataatcaattttta
ataaataaaaaaaatgctatttttgataatttttcaaaagatgatatggtgctgctatac
acaaaaaaagactatcgctggaatgacgccagtatcgatagcgacatacatttgaacata
tataaaactataaaggaagctaaatgtgtttgttatgctatgccacctcaaacagttgct
tatacgcttaaacatgattttgtaattccgaaagattatttcggttttgcagaattcgga
aaagtcgaaatttatgatattaaaaaatttgatgattggtatgagcgcgctccaagtgaa
atttctcactatatgtttgaagaaaatactgatgtaatggtaataaaaggctatggaatt
tacgcttatgcaagaaatttaggcgaacttgcaaaaaaaatagcaataattgaaaatagc
tgttatattttaaatttagaaaatttttaa

DBGET integrated database retrieval system