KEGG   Campylobacter hominis: CHAB381_0980Help
Entry
CHAB381_0980      CDS       T00577                                 

Definition
thiol:disulfide interchange protein DsbD (protein-disulfide reductase) (disulfide reductase) (EC:1.8.1.8)
Orthology
K04084  
thiol:disulfide interchange protein DsbD [EC:1.8.1.8]
Organism
cha  Campylobacter hominis
Brite
Enzymes [BR:cha01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.8  protein-disulfide reductase
     CHAB381_0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(917219..918943)
Genome map
AA seq 574 aa AA seqDB search
MDFKILESILFKILLSLLSFFTFCFAAPIQPFKAFVVDSTIQNEKIYFDFKIAEDIYVYK
NSFKIHFVKNSLLLNENAKFPDSKIYKNNEIFAGEFFITLPENIAKSDKFSIALDFIGCS
ASGFCYPPQTRSFSYEKKDGNYKIVSLNQKDLKNASFNEQTAIADDIKNKNFILTLLSFF
GYGILLSFTPCIFPMVPILSSVIVAKTSKNAGKGAFLVSLIYVLGISLAYAVTGFLASFF
GASLQSILQMPAVILGLCAVFVFLAFSMFGFYEIRLPSRLQTFFTQKGDKSSGYFGIFVM
GIFSALIVGPCVAAPLAGALLYITQSGDIFLGTSALFFLGFGSGIPLLLLGISAKFLPHP
GAWMNLITRIFGFLLLIMAIWLGTRVWGENFSLLLYGILGVSFAVFFGIFDFRVHKIRRV
ISLLALIYSVFLLVGFFSGAVSALKPFENFTTAKISGRNELQFTEISTLDDLENFVQNTK
KPVMVDFWASWCENCKLLEKDTFKDRKVYEILQNFDLVKIDVSRNGDEDLKLMQKFNVFG
PPALIFYKNGKELKDLQITGFIDVKNFMEILDEI
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
ttggattttaaaattttggagagtattttgtttaaaattttacttagtttattatctttt
tttactttttgttttgccgcaccaattcagccatttaaagcttttgttgttgattcgact
attcaaaatgaaaaaatttacttcgattttaagatagctgaagatatttatgtttataaa
aacagttttaaaattcactttgttaaaaatagtttgttattgaatgaaaatgcaaaattt
cctgatagtaaaatttataaaaacaatgaaatttttgcaggcgaattttttattacactg
cctgaaaatattgcaaaaagtgataaattttctattgcacttgattttatcggttgttct
gcaagcggtttttgttatccgccgcaaaccagaagtttcagttatgaaaaaaaagatgga
aattataaaatagtgtctttaaatcaaaaagatttaaaaaacgcctcttttaacgaacaa
acggctatagctgacgatataaaaaataaaaatttcattcttacacttttgagttttttc
ggttatggaattttgctttcgtttacgccttgtatttttcctatggtgccgatactttcg
tctgtaatagttgccaaaacttcaaaaaatgctggcaagggcgcatttttagtcagtctt
atttatgttttaggaatttctcttgcttatgcagttaccggatttttagcaagttttttt
ggagcaagtttgcaaagtattttgcaaatgccggccgtcattttaggactttgcgccgtt
tttgtatttttagctttttcaatgttcggattttatgagattcgtcttccttcgcgtttg
caaacattttttactcaaaaaggcgataaatcaagcggatatttcggcatttttgtgatg
ggaattttctccgctttaatagttggtccttgcgttgcggcaccattagccggtgcttta
ctttatattacacaaagcggagatatatttttaggaacgtctgctttattttttcttggt
ttcggttcaggaataccgctgcttttgcttggaataagtgcgaaatttttacctcatccg
ggagcttggatgaatcttataacacgaattttcggttttttgcttcttataatggcaatt
tggcttggaacgcgtgtttggggcgaaaatttttcacttttactttatggaattttaggt
gtaagttttgccgtattttttggaatttttgatttcagagttcataaaatcaggcgtgtt
atttcgcttttagcgttaatttattccgtttttctgcttgtaggattttttagtggtgca
gtttcggctttaaaaccttttgaaaatttcacgactgcaaaaatttcaggtaggaacgaa
ttgcaatttactgaaatttcaacattagatgatcttgaaaattttgtacaaaatacaaaa
aagcctgttatggttgatttttgggcaagttggtgtgagaattgcaagctcttggaaaaa
gatacttttaaagatcgtaaagtgtatgaaattttacaaaattttgatcttgtgaaaata
gatgtaagcagaaatggcgatgaagatctaaaacttatgcaaaaatttaatgttttcggt
ccgccggctttgattttttataaaaacggtaaagaacttaaagatttgcagataacgggc
ttcatagatgttaaaaattttatggaaattttagatgaaatttaa

DBGET integrated database retrieval system