KEGG   Campylobacter hominis: CHAB381_1020Help
Entry
CHAB381_1020      CDS       T00577                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cha  Campylobacter hominis
Pathway
cha00260  Glycine, serine and threonine metabolism
cha00750  Vitamin B6 metabolism
cha01100  Metabolic pathways
cha01110  Biosynthesis of secondary metabolites
cha01120  Microbial metabolism in diverse environments
cha01230  Biosynthesis of amino acids
Module
cha_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHAB381_1020 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CHAB381_1020 (thrC)
Enzymes [BR:cha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CHAB381_1020 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABS51636
UniProt: A7I239
Position
complement(958232..959662)
Genome map
AA seq 476 aa AA seqDB search
MKLFSTRDTKDSVEFSEALLNPSAAFGGLYAPEILPVCDKKFWQESENLSYRDFALKVIE
KFGFDISGEIFAEALKRYKNFDDQKCPVKFTKFSENCEILELYHGPTRAFKDMALQPFGE
ILSKIAVSRKENYLIMCATSGDTGPATLQTFANAKNTRVICLYPKNGTSEVQRLQMVNAD
AKNLKTIGIKGNFDDAQRALKNLLADNEFKDELAANGLKLSAANSVNFGRILFQIIYYLF
ANLHFKGRNFNVIVPSGNFGNALGAYYAKKMGANIADIRIASNANNVLTELFTKGIYDLR
KRSLIKTMSPAMDILISSNVERLLFDKFGDIRTRELMRDLKENRFYKLTDDELKELKNDF
KAGFSNDEECSEIIKKVSEKGILIDPHTANCFKLINENGKNLIVSTAEWLKFTPSMVKAI
NGGMKSDEKSEMNALAEKFNVKIPKSISSLFERSEIHKDIAEQNEIKNKIIEWIKK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttttctacaagagatacaaaagacagtgttgaattttcagaagcgctttta
aatccgagtgcggctttcggcggactttacgcgcctgaaattttgcctgtatgcgataag
aaattttggcaggagagcgaaaatttaagttacagagattttgctttaaaggttatagaa
aaattcggttttgatatttcaggcgaaatttttgcggaagcacttaaaagatataaaaat
tttgatgatcaaaaatgccctgtaaaatttacaaaattcagcgaaaactgtgaaattctg
gagctttatcatggacctacaagagcttttaaggatatggcacttcagcctttcggtgaa
attttaagcaaaatcgccgtttcgcgcaaagaaaattatctgataatgtgtgctacaagc
ggcgatacaggacctgctacattacaaacttttgcaaatgcaaaaaacacgcgcgtaatt
tgtctatatcctaaaaacggcacaagcgaagtgcaaagacttcaaatggtaaatgcggat
gccaaaaatctgaaaactataggtataaaaggaaatttcgatgatgcgcaaagagcattg
aaaaatcttttagccgataatgaatttaaagatgagcttgctgcaaacggtttaaaattg
agcgccgcaaactctgtaaatttcggacgaattttatttcaaatcatatattatctgttt
gcaaatctgcattttaaagggcgaaatttcaatgtaatcgtgccaagcggaaatttcgga
aatgcgcttggagcgtattatgctaaaaaaatgggtgcgaatatcgcagatatccgtatt
gcttcaaatgcaaacaatgtcttgacagagctttttacaaaaggcatttatgatttaaga
aagcgttcgcttatcaagacgatgagcccggctatggatattttaataagttcgaatgtt
gagcggcttttgtttgataaattcggcgatatcagaacgcgcgaacttatgagagattta
aaggaaaacagattttataagcttacggatgatgaactgaaagagcttaaaaatgatttt
aaagcgggcttttcaaatgatgaagagtgctctgaaataattaaaaaagtaagtgaaaaa
ggaattttaatcgatcctcacaccgcaaattgttttaaactgataaatgaaaacgggaaa
aatttaatcgtatcgaccgccgaatggttgaaatttacaccatcgatggtaaaagcgata
aatggtggtatgaaaagcgatgaaaaaagcgaaatgaatgctcttgcggaaaaatttaat
gttaaaattccaaaaagtatttcatcgcttttcgaaagaagtgaaattcacaaagatatc
gcagaacaaaatgaaataaaaaataaaattatagaatggataaaaaaatga

DBGET integrated database retrieval system