KEGG   Campylobacter hominis: CHAB381_1086Help
Entry
CHAB381_1086      CDS       T00577                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cha  Campylobacter hominis
Brite
Enzymes [BR:cha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CHAB381_1086
Secretion system [BR:cha02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CHAB381_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1022959..1023672)
Genome map
AA seq 237 aa AA seqDB search
MKKIIFVSAALAISLNAATNEEILGLYSGAPKDIKIEITDRKAVDGLDGFEAVVLKMSQG
DMSQEDIAFTKDNLFIPDLVNVKTGMSYKDQIRQTRVYSLLADVYPKEEAKNIIKLGNDA
KKPTLVVFTDAECPYCRKEMEKAEDRLKTHNLEIVMTSVHGESGNVKSALIYKETAKAKS
DDEKLKVLHKYYNMTEKGDKSKVSDAEFKAAEDLAKKYQSNGINGVPFIVEKDKISK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattatttttgtttcagcagcgcttgcaataagtttaaatgccgctacaaat
gaggaaattttgggactttactcaggtgcgcctaaagatataaaaattgaaatcacagat
agaaaagctgtagacggtctggacggtttcgaagctgttgtgcttaaaatgtcgcaaggt
gatatgtctcaagaagatattgcatttacaaaagataatctttttattcctgatttggta
aatgtaaaaacaggaatgagttataaggatcaaattagacaaactcgtgtgtacagtttg
cttgcagacgtttatccgaaagaggaagctaaaaatatcataaaacttggaaatgatgct
aaaaaacctactttagttgtttttacagacgcagaatgcccatattgccgcaaagagatg
gaaaaagccgaagacagacttaaaactcacaatcttgaaatcgtgatgacatcggttcat
ggcgagagcggtaatgtaaaaagcgctttaatttataaagaaacggctaaagctaaaagt
gatgatgaaaaattaaaagtacttcataaatattataatatgaccgaaaaaggcgataaa
agtaaagtaagcgatgctgagtttaaagcggctgaagatcttgctaaaaaataccaaagc
aatggaataaacggtgttccgtttatcgtagaaaaagataaaatttctaaataa

DBGET integrated database retrieval system