KEGG   Campylobacter hominis ATCC BAA-381: CHAB381_1145Help
Entry
CHAB381_1145      CDS       T00577                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cha  Campylobacter hominis ATCC BAA-381
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cha03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1079457..1080026)
Genome map
AA seq 189 aa AA seqDB search
MKNNTKFDELVATFEKLPGVGKKSALRYAYHISINDPFLGLNLANSIENAVRNLRRCEVC
GAICEDEICEVCCDTSRDREKICIVESPKDILIFEENAIFDGLYFVLDSSGDEIITKLQR
MIELNGVKELIFAMTPGVNSDMLMLYVEDKISIPNLKFSKIAQGIPTGVSVDSIDFISLS
KALKDRVGI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataatacaaaatttgacgaacttgtggctacttttgaaaaacttccgggagtc
ggtaaaaagtcggctctgcgttatgcttatcatataagtataaatgatccttttttagga
cttaatttagcaaattctatagaaaatgccgtgcgaaatttaagacgttgtgaagtttgc
ggggcaatttgcgaagatgaaatttgcgaagtttgttgcgatacttcaagagatcgtgaa
aaaatctgcattgtagaaagtccgaaagatattttaatttttgaagaaaatgcgattttt
gacgggctttattttgtgcttgacagttcaggcgacgaaattattaccaaacttcaaaga
atgattgaattaaatggcgtaaaagagcttattttcgcgatgacgcccggagtaaattcc
gatatgcttatgctttatgtggaagataaaatttcaattccaaatctgaaattcagtaaa
atcgctcaaggaattccaacaggtgtaagcgtggatagtatagattttatttcgctcagc
aaagccttaaaagatcgcgtgggaatttag

DBGET integrated database retrieval system