KEGG   Campylobacter hominis ATCC BAA-381: CHAB381_1209Help
Entry
CHAB381_1209      CDS       T00577                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cha  Campylobacter hominis ATCC BAA-381
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cha00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1145530..1146036)
Genome map
AA seq 168 aa AA seqDB search
MNVTLKNNGFWDFKDAICFVKSANFGIFFGADNNYKNTFVLGIGGNMGDTRARFERFLRV
LRHDRRFFVSQSSIILKNKPFGFLKQNDFLNAVLIVQTSLFPQAVLKLLNHFEKIFGRKR
SFKNAPRTLDLDILYFDKKVRKSARLILPHSGVNDRVSVILPFGSLRS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaactttaaaaaataatggattttgggattttaaagacgctatttgttttgta
aaatcagcaaatttcggaattttttttggtgcagataataattataaaaatacttttgtg
cttggaatcggtggaaatatgggcgatacgcgcgcgcgtttcgagcgatttttgcgcgtt
ttaaggcatgatagacgtttttttgtaagtcaaagttccattattctaaaaaataaacct
tttggatttttaaaacaaaatgattttttaaatgctgttttgatagtacaaacatcgcta
tttccgcaagcagtattaaaacttttaaatcattttgaaaaaattttcggacgaaaaaga
agttttaaaaatgcgccgcgaactcttgatttggatattttatattttgataaaaaagtc
agaaaaagtgcgcgtctgattttaccgcatagcggtgtaaatgaccgtgtaagtgttatt
ttgccgtttggaagtttaaggagttga

DBGET integrated database retrieval system