KEGG   Campylobacter hominis: CHAB381_1209Help
Entry
CHAB381_1209      CDS       T00577                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cha  Campylobacter hominis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CHAB381_1209 (folK)
Enzymes [BR:cha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CHAB381_1209 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1145530..1146036)
Genome map
AA seq 168 aa AA seqDB search
MNVTLKNNGFWDFKDAICFVKSANFGIFFGADNNYKNTFVLGIGGNMGDTRARFERFLRV
LRHDRRFFVSQSSIILKNKPFGFLKQNDFLNAVLIVQTSLFPQAVLKLLNHFEKIFGRKR
SFKNAPRTLDLDILYFDKKVRKSARLILPHSGVNDRVSVILPFGSLRS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaactttaaaaaataatggattttgggattttaaagacgctatttgttttgta
aaatcagcaaatttcggaattttttttggtgcagataataattataaaaatacttttgtg
cttggaatcggtggaaatatgggcgatacgcgcgcgcgtttcgagcgatttttgcgcgtt
ttaaggcatgatagacgtttttttgtaagtcaaagttccattattctaaaaaataaacct
tttggatttttaaaacaaaatgattttttaaatgctgttttgatagtacaaacatcgcta
tttccgcaagcagtattaaaacttttaaatcattttgaaaaaattttcggacgaaaaaga
agttttaaaaatgcgccgcgaactcttgatttggatattttatattttgataaaaaagtc
agaaaaagtgcgcgtctgattttaccgcatagcggtgtaaatgaccgtgtaagtgttatt
ttgccgtttggaagtttaaggagttga

DBGET integrated database retrieval system