KEGG   Campylobacter hominis ATCC BAA-381: CHAB381_1274Help
Entry
CHAB381_1274      CDS       T00577                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cha  Campylobacter hominis ATCC BAA-381
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cha01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cha00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cha00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1210334..1211515
Genome map
AA seq 393 aa AA seqDB search
MNKKAYYGKFGGQFVPETAMFALEELEYAYKHITKTKEFKDELNWLLHEYVGRPSPLYYA
KKLSKYYGHEIYLKREDLNHTGAHKINNALGQALLAKKMGKTKVIAETGAGQHGVATATA
AALLGLECNIYMGEVDAARQRLNRFRMELLGAKVVEIRSGLRTLKEATTAAIQAWVNEIE
NVFYVIGSVVGPYPYPEIVKHFQSVIGKETKAQLKKMGIKADYIVACVGGGSNAMGIFSA
FLKDKNVNLCGVEAGGLGADTPYNAATLTNGKAGIIHGMKTIVLQDKYGRILPVHSISAG
LDYPGVGPEHSNLFDTGRAHYEAVSDDEAINALKLLCKTEGIIPAIESAHALAYLDKLCP
KLKGHKTIVVNVSGRGDKDIDSIINYKKGTIYG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaagcgtattatgggaagtttggcggacaatttgtccctgaaacagcaatg
tttgcgttagaagaacttgaatatgcctacaaacatataacaaaaacaaaagaatttaaa
gatgagttgaactggttattgcatgaatatgtcggacgcccatcgccactttattatgcc
aaaaaacttagcaaatattacggacatgaaatttacttaaaacgcgaagatttaaaccat
accggcgcacacaaaataaataacgctctaggacaagctttgttagctaaaaaaatgggc
aaaacaaaggttatcgctgaaacaggagccggacagcacggcgtggctacagctacagcc
gctgctttactgggacttgaatgcaatatttatatgggcgaagtggatgcagcccgtcaa
agacttaacagatttagaatggaacttttaggcgcaaaagttgtagaaataagatcaggg
cttagaacactaaaagaggccacaacagcagcaattcaagcttgggtaaatgaaatagaa
aatgttttttatgtaataggttcagtcgtcggtccttatccttatcctgagattgtaaaa
cacttccaaagtgtaataggaaaagagacaaaagctcaacttaaaaaaatgggaataaaa
gccgattatatagtagcttgcgtaggcggcggaagtaatgctatgggaattttcagcgca
tttttaaaagataaaaacgttaatctttgcggcgttgaagcaggaggtcttggagccgat
actccttataatgcggcaactcttacaaatggtaaagctggcattattcacggaatgaaa
acaattgttttacaagataaatatggcagaattttgcctgtacacagtatttcggcagga
cttgattatcctggcgtaggacctgagcattcaaatctatttgacactggacgcgcacac
tatgaagctgtaagcgatgatgaagctataaatgcgcttaaattactttgcaaaaccgaa
ggaatcatcccggcaatcgaatcggcacacgctttggcatatttggataaactttgcccg
aaacttaaaggtcataaaactatagtcgtaaatgtgagtggcagaggtgataaagacata
gattcaatcataaactataaaaaaggaacaatttatggataa

DBGET integrated database retrieval system