KEGG   Campylobacter hominis: CHAB381_1275Help
Entry
CHAB381_1275      CDS       T00577                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cha  Campylobacter hominis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CHAB381_1275 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHAB381_1275 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHAB381_1275 (trpA)
Enzymes [BR:cha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CHAB381_1275 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211508..1212251
Genome map
AA seq 247 aa AA seqDB search
MDKIKKAFENGANIGYIVAGYPNVEHTKNFLNSLDECALDIVEIGIPYSDPLADGPVVFN
ASFQAVQNGVNTDTVFKILSEVETKKPLIFLVYFNLIFAYGMKKFIKKCAEAGISGLIIP
DLPFEENEEIFKLCEKEKIALIPLISITSEHRAKKVLSRAGGFIYAISAIGVTGTKLTPM
ERLKNMLSDLKKMSDLPVAVGFGIRTNEDIRNMRKYADGVILGTSIVKLSEEFEGKEFLQ
KINELFK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggataagataaaaaaagcgtttgaaaatggagcaaatatcggttatatcgttgccgga
tatccaaatgtagagcatacgaaaaattttttaaattcacttgatgagtgcgcacttgat
attgttgaaataggtattccatattcagatcctttagctgatggacctgtggtgtttaac
gcaagctttcaggcggtgcaaaacggcgtaaatacggacactgtatttaaaattttaagt
gaagttgaaactaaaaaaccgcttatttttttagtttatttcaatttgatttttgcctac
ggaatgaaaaaatttatcaaaaaatgcgctgaagctggaatttcaggtttgataattccg
gatcttccttttgaggaaaatgaagaaatttttaaactttgtgaaaaagaaaaaatcgct
ttaataccgctaataagtataacaagcgaacatagagcaaaaaaagttttaagcagagct
ggcggatttatatacgcaatatcggcaataggcgtaacaggaacaaaactaactccaatg
gaaagactaaaaaatatgctttctgatcttaaaaaaatgagcgatttaccggtagctgtc
ggctttggtatacgcacaaacgaagatataagaaatatgcgcaaatacgcggacggtgta
atacttggaacttctatcgtaaaactttccgaagaatttgaaggtaaagagtttttacaa
aaaataaacgagctttttaaataa

DBGET integrated database retrieval system