KEGG   Campylobacter hominis: CHAB381_1275Help
Entry
CHAB381_1275      CDS       T00577                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cha  Campylobacter hominis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CHAB381_1275 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHAB381_1275 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHAB381_1275 (trpA)
Enzymes [BR:cha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CHAB381_1275 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1211508..1212251
Genome map
AA seq 247 aa AA seqDB search
MDKIKKAFENGANIGYIVAGYPNVEHTKNFLNSLDECALDIVEIGIPYSDPLADGPVVFN
ASFQAVQNGVNTDTVFKILSEVETKKPLIFLVYFNLIFAYGMKKFIKKCAEAGISGLIIP
DLPFEENEEIFKLCEKEKIALIPLISITSEHRAKKVLSRAGGFIYAISAIGVTGTKLTPM
ERLKNMLSDLKKMSDLPVAVGFGIRTNEDIRNMRKYADGVILGTSIVKLSEEFEGKEFLQ
KINELFK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggataagataaaaaaagcgtttgaaaatggagcaaatatcggttatatcgttgccgga
tatccaaatgtagagcatacgaaaaattttttaaattcacttgatgagtgcgcacttgat
attgttgaaataggtattccatattcagatcctttagctgatggacctgtggtgtttaac
gcaagctttcaggcggtgcaaaacggcgtaaatacggacactgtatttaaaattttaagt
gaagttgaaactaaaaaaccgcttatttttttagtttatttcaatttgatttttgcctac
ggaatgaaaaaatttatcaaaaaatgcgctgaagctggaatttcaggtttgataattccg
gatcttccttttgaggaaaatgaagaaatttttaaactttgtgaaaaagaaaaaatcgct
ttaataccgctaataagtataacaagcgaacatagagcaaaaaaagttttaagcagagct
ggcggatttatatacgcaatatcggcaataggcgtaacaggaacaaaactaactccaatg
gaaagactaaaaaatatgctttctgatcttaaaaaaatgagcgatttaccggtagctgtc
ggctttggtatacgcacaaacgaagatataagaaatatgcgcaaatacgcggacggtgta
atacttggaacttctatcgtaaaactttccgaagaatttgaaggtaaagagtttttacaa
aaaataaacgagctttttaaataa

DBGET integrated database retrieval system