KEGG   Chlamydia psittaci 6BC: G5O_0248Help
Entry
G5O_0248          CDS       T02097                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase, putative (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
chb  Chlamydia psittaci 6BC
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:chb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    G5O_0248
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G5O_0248
  Amino acid metabolism
   00310 Lysine degradation
    G5O_0248
Enzymes [BR:chb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     G5O_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
234704..235873
Genome map
AA seq 389 aa AA seqDB search
MFEFRFPKIGETGSGGLVVRWLKQVGENVAKDEPVIEVSTDKIATELASPKAGKLIRCLV
KEGDEVAAEEVIALIDTESAVEEEVVVEELSPNASCPQDSGKNSAWFSPAVLSLAHREGV
SLQQLQQISGTGNDGRVTRRDLENYILEMRQPSCPNIANANENRIPMSPLRRAIASSLSK
SSDEVPHASLIVDIDVTDLMNLIAEEKDRFFATHGVKLTITSFIIQCLAKALEQFPLLNG
SLDGDTIVVKKSINVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKTLADLSARARANKLDP
SETQDGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVVVRDDDSLAIRKMVYVTL
TFDHRVLDGIYGSEFLTSLKNRLESVTMS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatttcgatttccgaaaataggagagactggttctggagggttggtagttcgt
tggctcaagcaggtgggagagaacgttgcaaaagatgagcctgtaattgaagtatctact
gacaagattgctacggagttagcctctcctaaagcagggaaattaattcgctgtctcgta
aaagaaggtgatgaagttgctgccgaagaagtgatagccttaatagatacggagtctgct
gtcgaggaagaggtcgttgtcgaagaactgtcacccaatgcttcgtgtcctcaagattct
gggaagaattcggcatggttttctccggcagttcttagtttggcacaccgtgaaggtgtt
tctctccagcaactacaacagatttctggaacaggaaatgatgggcgcgtcactcgtagg
gatttagaaaactatatccttgaaatgcgccaaccttcgtgcccaaatattgcgaatgcg
aatgaaaatcgcattcccatgtctccactacgtagagctatagcttcctcgttatctaaa
tcttcagatgaagtgcctcatgcttctcttattgtggatattgatgtcacagatttgatg
aatttaattgctgaagagaaggatagattttttgcaacgcatggtgtgaaactcacaatt
actagtttcattatccagtgtttagccaaggctttggagcagttcccgttattgaatgga
tctttagacggcgatacaattgttgtgaagaaatcaatcaatgtgggtgttgctgttaat
ttgaataaagagggcgttgttgttcctgttattcataattgtcaggatcgtggtttagta
agcattgcgaaaactctcgctgatctttctgcaagagctcgggcaaataaacttgatcct
tcagaaactcaagatggtagtgtcaccgttactaatttcggtatgacgggagctttaatt
ggcatgccaataattcgttatccggaagtagctattttaggaataggaacgatacaaaaa
cgtgttgttgtgcgtgatgacgattctttagctattcgcaaaatggtctatgttaccctc
acgtttgaccacagggtattggatggtatttacggtagtgaatttttaacctcattgaaa
aatcggttagagtctgttacgatgagctaa

DBGET integrated database retrieval system