KEGG   Chlamydia psittaci 6BC: G5O_0403Help
Entry
G5O_0403          CDS       T02097                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
chb  Chlamydia psittaci 6BC
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:chb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    G5O_0403
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    G5O_0403
Enzymes [BR:chb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     G5O_0403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
425631..427082
Genome map
AA seq 483 aa AA seqDB search
MNLKELLHNTKAKIYGKISSVEVRNLTRDSRNVGVGDIFIASKGKHSDGNDFSHLAIENG
AIAVASSIYNPFLPVVQIISSDLPQLEADLAAKYYGHPSQKLCVVGITGTNGKTTVSHLI
KFLFDACDKPAGLIGTIEHILGNSRIQDGYTTPESCLLQKYLAEMVKSNLSAAVMEVSSI
GLAVNRLANVHFDVGVLTNITLDHLDFHSSFEEYKQAKLKLFSMLPSSGLAVVNNDLHYA
AQFIEATQAQPITYGIEQHADYRASNLRFSPFGTDFDLLYKGETFACSSPLIGQHNIYNV
LAAISVAHQRLGCDLQQLISAVANVETPRGRLEPVFSGPCPIYIDYAHTPDALDNVCKTL
QALLPQDGRLIVVFGCGGDRDQSKRKIMAQVVEKYGFAVVTTDNPRGEDPEMIINEICSG
FFKRNFSIEIDRKQAITYALSIASDRDIVLVAGKGHETYQIFKHQTIAFDDKEIVLEVLS
SYV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaagaactcctccacaataccaaagcgaaaatttatgggaaaatttcttct
gtagaagtaagaaatctcacaagagattctcgtaatgttggagttggagatatctttata
gccagtaaaggcaagcactctgatggtaatgacttttcccatttagctattgaaaatgga
gctattgctgtagcttcttctatttacaatccttttttacctgttgttcaaattatttct
tccgatcttcctcagcttgaagcggatcttgcagcaaaatactacggtcatccttcgcaa
aaactctgtgtggttggtattacaggcaccaatgggaaaactacagtttcccatttaata
aaatttctgtttgatgcttgcgacaagcctgcaggcttaataggtactattgagcatatt
ctgggaaatagtcgtattcaagatgggtataccactcctgaatcctgtttgttgcaaaag
tatttagctgagatggtgaagagcaatctttctgctgcagttatggaagtatcttctatc
ggtcttgctgtcaacagactggctaacgtccattttgatgttggtgtcttaactaacatt
actctagatcatttagattttcattcttcgtttgaagagtataaacaagcaaagcttaag
ctattttcgatgcttccttcttcaggtctagctgtagtgaataacgacttacattatgct
gcgcagtttattgaagctacccaagcccaacctattacctatggaatcgagcagcatgca
gattatcgcgcttctaatttgcgcttttctccgttcggaacggattttgacttactctat
aaaggggaaacctttgcatgttcctcacccttaatagggcagcacaacatttataatgtt
cttgctgcgatttctgtcgctcaccaacgattaggttgtgatttacaacaactgatctct
gctgttgccaatgtagaaacccctagagggcggttagaacctgtattttccggcccctgt
cctatttacattgattatgctcatactcccgatgccttagataatgtatgcaaaacactc
caagctctacttccccaagatggaaggcttatcgtggtctttggatgtggaggcgatcga
gatcagagcaaaagaaaaatcatggctcaagtcgtcgagaagtatggattcgctgttgtg
actacggacaatcctcgcggcgaagatccagaaatgatcattaatgaaatttgttcaggt
ttttttaaaagaaatttttctatcgaaatcgacagaaaacaagcaattacatatgctttg
tccattgcctcagatagggatatagtgttagtggcaggtaaagggcatgagacgtaccag
atctttaaacatcaaaccatcgcttttgatgataaggaaatcgtgctcgaggtattgtcg
tcttatgtttaa

DBGET integrated database retrieval system