KEGG   Chlamydia psittaci 6BC: G5O_0687Help
Entry
G5O_0687          CDS       T02097                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
chb  Chlamydia psittaci 6BC
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:chb00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(743746..744360)
Genome map
AA seq 204 aa AA seqDB search
MKDKVRVPFSPDHPLCVPKLFTISAPAGAGKTTLVRMLAQEFPDSFQKTLSLTTRAPRPE
EVPGVDYQFVSQEEFQRRLDNDDFLEWVALFGEYYGTSRLGIDEIWKSGRHAVAVIDVEG
ALVLRSKIPTVTIFISAPSQEELERRLKQRGSEQDTQRQERLQHSLIEQAAANKFEYVII
NDDLEKSYEVLKSIFIAEEHRNVL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaagttcgtgttcctttttctcccgatcatcccctatgcgtaccaaaatta
tttactattagtgctcctgctggagctgggaaaacaacgctagtacgtatgttggctcaa
gaatttccagattcttttcagaagactttatcacttacaacacgagcacctcgtcctgaa
gaagttcctggagtagattatcagtttgtttctcaagaggagtttcaacgacgcttagac
aatgatgattttcttgagtgggtagcactttttggagagtattacggaacgagtcgttta
gggattgatgaaatttggaaatctgggagacacgcggttgcggttattgacgtggaagga
gctttggtcttgcggagtaaaattcccacagtgacgatttttatttctgcgccatctcag
gaagagctagaaaggcgtctaaaacaaagaggatcagaacaagatactcaaagacaagag
cggttgcagcatagtcttattgaacaagctgcggctaataaatttgaatacgtcattatc
aatgatgatttggagaaatcttacgaggttttgaaaagtatttttatagcagaagaacat
aggaacgtattatga

DBGET integrated database retrieval system