KEGG   Chlamydia psittaci 6BC: G5O_0886Help
Entry
G5O_0886          CDS       T02097                                 

Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
chb  Chlamydia psittaci 6BC
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    G5O_0886
Enzymes [BR:chb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     G5O_0886
Transfer RNA biogenesis [BR:chb03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    G5O_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
972537..973517
Genome map
AA seq 326 aa AA seqDB search
MPSHLLDYQRVAESIVEKTIAELIHYRQRLPLVPFWTKPDGSFVTPADYAVQYCLQKKLS
TTFPHIPFIGEEVLDPVSDKHKINSILEFIHRLDSQVTPEDLLETLSPNQEASTLYWLVD
PIDGTSGFIKNRFFASAVSLIYEDKPILAVMACPCTDRHTFKIYSAAKNYGVSLFGTAIE
TRHYLKSGETLTGKFCEASLAARNQQHHATRLLSLSLPGQPQACRVDSQYKYAMVAEGAV
DFFIRYPFAISQARAWDHAPGAFLVEESGGVVSDIFGNSLNYRREDFILENHPIILASGN
AEIHRITLDALQEQANIVSEENLLAY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcatttactagactatcaaagagttgcagaaagtatagttgagaaaaccatc
gccgagttaatccattatcgacaacgccttccgctagtccctttctggacaaaacccgac
gggtcttttgtcacacccgcagattatgctgtccaatactgccttcaaaaaaagctatca
acaacttttccacatattccgtttatcggggaagaagtcttagaccctgtaagcgataaa
cataaaattaatagtattttagaattcattcacagactagattcgcaggtgacacctgag
gatcttttagaaacattaagccccaatcaagaagcctcgactttatactggcttgttgat
cctattgatggtacgtcaggatttattaaaaaccgtttttttgcctctgcagtatcctta
atttatgaggataagcctatactcgcggttatggcgtgcccatgcacagaccgccatact
tttaaaatctattctgctgctaaaaactatggggtttctttatttggtacggcaattgaa
actcggcattatttaaaatctggagaaacgctaacggggaagttttgtgaagcatctcta
gctgcacgtaaccaacagcaccacgctacacgcttattaagtctctccttgccagggcaa
ccccaagcttgtcgagttgacagtcaatacaaatatgctatggttgctgaaggcgctgta
gacttttttatccgctacccctttgctatttctcaagcaagagcgtgggatcatgctcca
ggggcttttttagtagaagagtctgggggcgtagtttccgatatttttggaaattcgctc
aactatcgtcgagaagatttcattttagaaaaccatcccataattctagcttccgggaat
gcggaaattcacagaattacgttagacgccttacaagaacaagcaaacattgtttctgaa
gaaaacttgctagcttactaa

DBGET integrated database retrieval system