KEGG   Chlamydia psittaci 6BC: G5O_0919Help
Entry
G5O_0919          CDS       T02097                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
chb  Chlamydia psittaci 6BC
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:chb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1008802..1010070
Genome map
AA seq 422 aa AA seqDB search
MKKAIIIGAGISGLSTAWWLHRKFPNSELVIIDKADRPGGLIYSDYQKNFALDLGPKGFL
VRGEGQYTLGLIRDLQLEEALIVSDKTAKKRFIRYKGKTRKVSPWTLIKEGLPFAIIKDL
FASRYTKDSSVYDFLSRHSTINLIHNVLNPVVTAIRAGHSHLLSAHMAFPSLSQREAKTG
SILRSFLKEPSKKKTSGAPYLASLRPNLGILIDTLVKKLPATWKFSSPVTKIECFPSQVV
VSTTQETFSGDLAIYTGATSLLPSLINIPGLQQLANKTLHWDLSCATLGWNRDMPSIPKG
YGMLFSDEPPLLGIVYNSRVFPNQMPGKTVLSLLLENRWHQEEAFAFSLAAISEYLGIST
KPDVFSLFSPEEGLPQHGVGFLEMKNQILPVLPHNLKIVGQNFSGPGLNRCVASAYQTVA
AI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagccattatcataggcgcaggaatttcagggttatccacagcgtggtggtta
cataggaaattccccaatagcgaacttgtaattatagataaggcagatcgacctggtggg
cttatctactcagattaccaaaagaattttgccttggatctcgggcctaaaggttttcta
gtacgtggtgagggacagtataccctcggattaattcgtgatttacaactggaagaggct
ctcattgttagtgataaaaccgcgaaaaaacgttttatacgttacaaagggaaaacacga
aaagtctccccatggacattaataaaagaaggtttgcctttcgctatcatcaaagatctc
tttgcctcccgctatacaaaagatagctctgtatatgatttcctaagtcgccatagcaca
ataaatcttattcacaatgtattaaatcctgttgttaccgcaattcgtgcaggacacagt
catctactttctgctcatatggccttcccttccctttctcaacgcgaagcaaaaacagga
tccattttacgcagcttcttaaaagaaccttcgaagaaaaaaacatccggagctccttat
ctagcttcgctacgtcccaatctaggcatcctcattgatactttagtaaaaaaactaccc
gcaacgtggaagttttcttctcctgttacaaagatcgagtgtttcccatcccaggttgtc
gtatccactacacaagaaacattctcaggagatctagcaatatatacgggggccacgtct
ctacttccttctcttattaatattccaggactgcaacagcttgcgaataaaactcttcat
tgggatctctcgtgtgcaacattggggtggaatagggatatgccttctatccctaaaggt
tatggtatgctgttctctgacgaaccaccgttattaggtattgtctataactcacgagtc
ttccctaaccagatgcctgggaaaacagttctatcattactattagaaaaccgctggcat
caagaagaagctttcgctttttctttagcagcgatttctgagtatttagggatttctaca
aaacccgatgtattttcattattttccccagaagaaggtctacctcaacacggcgtaggg
tttttagaaatgaaaaatcagatactccctgtacttcctcataatctaaaaattgtcggg
caaaacttctctggtccaggattaaacagatgtgtagcctcagcctatcagactgttgct
gctatctaa

DBGET integrated database retrieval system