KEGG   Chlamydia psittaci 6BC: G5O_0950Help
Entry
G5O_0950          CDS       T02097                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
chb  Chlamydia psittaci 6BC
Pathway
chb00010  Glycolysis / Gluconeogenesis
chb00260  Glycine, serine and threonine metabolism
chb00680  Methane metabolism
chb01100  Metabolic pathways
chb01110  Biosynthesis of secondary metabolites
chb01120  Microbial metabolism in diverse environments
chb01130  Biosynthesis of antibiotics
chb01200  Carbon metabolism
chb01230  Biosynthesis of amino acids
Module
chb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:chb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G5O_0950
  Energy metabolism
   00680 Methane metabolism
    G5O_0950
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    G5O_0950
Enzymes [BR:chb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     G5O_0950
Membrane trafficking [BR:chb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    G5O_0950
Exosome [BR:chb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   G5O_0950
  Exosomal proteins of melanoma cells
   G5O_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEB55913
Position
1043226..1043909
Genome map
AA seq 227 aa AA seqDB search
MAFLILLRHGKSVWNEKNLFTGWVDIPLSQKGIDEAMLAGEAIKDLPIDCIFTSSLVRSL
MTALLAMTHHNSKKIPYIVHDDPQHKHMSKIYSDEANHMIPLYRSSALNERMYGELQGKN
KKETAEQFGEEQVKLWRRSYKTAPPKGESLYDTGQRTIPYFHETIFPLLQNSKNVFVSAH
GNSLRSLIMDIEKLSEEEVISLELPTGKPIVYLWTGHTFERHPEPFG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcttatcttattacgacacggaaaatccgtctggaatgaaaaaaaccttttt
acaggatgggtggatatccccctgagtcaaaaaggtattgacgaagcaatgcttgcaggc
gaggcaatcaaagacctccccatagattgtatctttacctcctctcttgtgaggagttta
atgacggcattgcttgctatgacacatcacaattctaaaaaaatcccttacattgttcat
gatgatcctcaacacaagcacatgagcaagatctatagtgatgaagcaaaccacatgatc
ccgctttaccgttccagtgcactaaatgaaagaatgtacggagagctccaaggaaaaaat
aaaaaagaaaccgctgagcaatttggagaggagcaggtaaaattgtggagacgtagttat
aagactgcccctcctaaaggcgaaagtctttacgatactgggcaacgcactatcccctat
tttcatgaaactattttccctttgttgcaaaattcaaaaaatgtgtttgtgtctgcacat
ggaaattcattacgttcactcatcatggatatagaaaaattaagtgaagaagaggtaatc
tctttggagttacccacaggaaaacccatagtgtatttatggaccggtcacacattcgaa
cgacacccagaaccatttggttaa

DBGET integrated database retrieval system