KEGG   Chlamydia psittaci 6BC: G5O_1050Help
Entry
G5O_1050          CDS       T02097                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
chb  Chlamydia psittaci 6BC
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:chb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:chb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1156838..1157326)
Genome map
AA seq 162 aa AA seqDB search
MCKILGIVACDPRGVMGKQGKLPWNYPEDIEFFSKTIGNHVLIMGRKTSEGLPDKYKKNR
KIIVFSRDYHESFENVIWVSSLEEFRRLEQLSSIFLIGGGELFSLFLENRMVDGCFITHI
HKCYEGDVFFPLSLIKGWRKTVLDEKENLTFCFYENFADCHS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaaatactcggtatagttgcttgtgacccccggggagtcatgggaaagcaagga
aagcttccgtggaactatcctgaagatatcgaatttttttccaaaactataggaaatcat
gtcctaatcatggggagaaagacttctgagggtcttcctgataagtataagaagaaccgg
aagattattgtcttttccagggattatcatgaaagtttcgagaatgtaatctgggtatct
tctttagaggaatttagacgtttagaacaactttcttctatttttcttattggcggagga
gaattgttttctttatttttagaaaatcggatggtggatgggtgtttcataactcatatt
cacaagtgttatgagggtgatgttttcttccctctatctttaatcaaagggtggaggaaa
actgttttagatgagaaagagaacttaacattttgtttttatgaaaatttcgccgattgt
cactcgtag

DBGET integrated database retrieval system