KEGG   Chlamydia psittaci C19/98: CPS0C_0136Help
Entry
CPS0C_0136        CDS       T01863                                 

Gene name
ruvA
Definition
holliday junction DNA helicase (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
chc  Chlamydia psittaci C19/98
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:chc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPS0C_0136 (ruvA)
Enzymes [BR:chc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CPS0C_0136 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124643..125266
Genome map
AA seq 207 aa AA seqDB search
MYDYIRGVLTYISSGTMVVESQGLGFSIFAPDRWLMELSSQLHRELIVYTYTVVRETEHV
LYGFNTRGERECFRMLISFSGVGPKTGLAILNTFSLSKLCSIARAEDIKAIASVPGIGKK
TAEKLMVDLKQKLADLLPLDSQITASWGPAKPSCMEEGIQALAALGYPKSSAERMIAEAM
SELPDHASIAEILPIALKKNLQGLNKS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattcgtggtgtgcttacttatatcagttcaggaactatggtagttgaa
agtcagggactggggtttagtatttttgctcctgatagatggcttatggaattgtcaagt
caactacaccgcgagcttatagtctatacttatactgttgttcgtgaaactgagcatgtt
ctctatggatttaatactcgtggagaacgcgagtgtttccgtatgttaatttcattttca
ggagtgggacctaagacaggtttagcgattttaaatacattttctcttagcaaattgtgt
tctatagctcgtgctgaggatatcaaagctatagcttctgttccgggtatagggaagaaa
acagctgagaaacttatggtggatttgaagcaaaagcttgcagacttactccctttagat
tcgcaaatcaccgcttcttggggaccagcaaaaccttcttgtatggaagagggaatacaa
gctttagcagcattaggctatccaaaatcctcagcagagagaatgatcgccgaagctatg
agcgagctcccggatcatgcgtcaatagcagaaattcttcctattgctctaaagaagaat
ttacaaggtttgaacaagagctag

DBGET integrated database retrieval system