KEGG   Chlamydia psittaci C19/98: CPS0C_0196Help
Entry
CPS0C_0196        CDS       T01863                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
chc  Chlamydia psittaci C19/98
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:chc00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:chc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
179579..180913
Genome map
AA seq 444 aa AA seqDB search
MAAAEVFGGCVLEGSVRVSGAKNSTTKLLVASLLSDRKCILRNVPDIGDVRLTVELCRSL
GSIIHWDKQAEVIEIHTPEIRMSEVSAQFSRVNRIPILLLGALLARCPEGVIVPCVGGDA
IGERTLNFHFEGLERLGAKVVYDGHGYQAAAPQGLVGAYITLPYPSVGATENLILASVRA
QGRTIIKNAALEVEILDLILFLQKAGVEITTDNDKTIEIFGCDDFYEVDHWVIPDKIEAA
SFGMAAVLTGGRIFVENAEQYLMIPFLKTLRSIGGGFSVTETGIEFFYNEPLKGGVVLET
DVHPGFLTDWQQPFSVLLSQAEGSSVIHETVHENRLGYLRGLQQMGANCELFYQCLSSKA
CRYATGNFPHSAVIHGATPLKASELVIPDLRAGFAYIMAALIAEGGPSLIRNTQLLDRGY
YNWVDKLNSLGAKIHLLSLDPVAF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagctgaagtttttggtggttgtgtgttagaaggttctgtgcgggtatctggg
gccaaaaactcgacaaccaagttactcgttgcgtcattattatcggatcgcaaatgcatt
ttacgtaatgtccctgatataggagatgtacgtttaactgttgaattgtgccgttcttta
ggttctataatacattgggataaacaagcagaagtcatagagattcatacacctgagatt
cgcatgtccgaagtgtccgcacagttttctcgggtgaatcgtattcctattttattatta
ggagctctactagctcgctgtccggaaggcgttattgtcccctgtgtcgggggagatgct
ataggggaaaggactctaaattttcattttgagggtttagaacggctaggggcaaaggtt
gtctatgacggacatggatatcaagctgctgctcctcaaggtcttgtcggagcgtacatt
actcttccttacccttctgtaggagctactgagaatttgatattagcttctgttcgcgct
cagggaagaacgatcatcaagaacgctgctttagaagtagaaatcttggatcttattttg
tttttgcaaaaagcaggagtggagatcactacagataatgataagacgatagaaattttt
ggttgtgatgatttttacgaagtagatcactgggtgatccccgataagatagaagcggct
tcatttggtatggctgccgtgcttaccggcgggcgcatttttgtagaaaatgccgagcaa
tatctgatgattccttttcttaaaaccttaaggtctataggaggagggttctcagtgaca
gaaacaggaatcgaattcttttataacgaaccattaaaaggtggtgttgtattagaaacc
gatgtacatcctggattccttacagattggcaacaacctttttcagttcttctctctcag
gcagaaggatcttctgtgattcatgaaaccgtgcatgagaatcggctagggtatttacgc
ggtttacagcaaatgggagcgaattgcgagctgttctaccagtgtttaagctcaaaggct
tgtcgttatgcaaccggaaattttccccatagtgctgtcattcacggagcgacaccattg
aaagcttctgaactggttattcccgatttgcgtgcaggatttgcctatattatggcagct
ctcattgcagagggtggaccttctttaatcagaaatacccagttgttagatcggggatat
tacaattgggtggacaaactgaactctttaggagcaaagatccacttgttgtccttagat
cccgtagcgttctaa

DBGET integrated database retrieval system