KEGG   Chlamydia psittaci C19/98: CPS0C_0660Help
Entry
CPS0C_0660        CDS       T01863                                 

Definition
(GenBank) diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
chc  Chlamydia psittaci C19/98
Pathway
chc00010  Glycolysis / Gluconeogenesis
chc00030  Pentose phosphate pathway
chc00051  Fructose and mannose metabolism
chc00680  Methane metabolism
chc01100  Metabolic pathways
chc01110  Biosynthesis of secondary metabolites
chc01120  Microbial metabolism in diverse environments
chc01130  Biosynthesis of antibiotics
chc01200  Carbon metabolism
chc01230  Biosynthesis of amino acids
chc03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:chc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS0C_0660
   00030 Pentose phosphate pathway
    CPS0C_0660
   00051 Fructose and mannose metabolism
    CPS0C_0660
   00052 Galactose metabolism
    CPS0C_0660
  Energy metabolism
   00680 Methane metabolism
    CPS0C_0660
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CPS0C_0660
Enzymes [BR:chc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPS0C_0660
Protein phosphatases and associated proteins [BR:chc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CPS0C_0660
Messenger RNA biogenesis [BR:chc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CPS0C_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEG85644
Position
681059..682717
Genome map
AA seq 552 aa AA seqDB search
MHVNSNDLNDVVIPGTPPLPRELQKFPSLIPTNDLRFSPKFDADVAKLFPNTYDSPYLKF
TSGTLDQPVRPLKVGVMLSGGPAPGGHNVIWGLLHSLKKIHPDSSLIGFLNNGQGILNNH
TVEITEEFMESFKNSGGFNCIGTGRTNIITEENKARCLKTVQALDLDGLVIIGGDGSNTA
TAILAEYFSQHHPKTCVVGVPKTIDGDLQHLFLDLTFGFDSATKFYSSIISNISRDTLSC
KAHYHVIKLMGRSASHIALECTLQTHPNITLIGEEIAEKNVPLNTIIHKVCSIIADRAAM
GKYYGIILIPEGIIEFIPEINNLVKEIERIPEDADKFSSLSRESQKLLKSFPETIAKQLL
NDRDAHGNVYVSKISVDKLLIHLVDNHLKKHFKNVPFNAISHFLGYEGRSCLPTKFDNTY
SYALGYGAGVLTYNRCNGYLTVIESLINIVDKWRLRAMPIVKMFTTKKKSDGTIKPLIKK
SLIDISSPAFIKFKLYRKIWALEDSYRFLGPLQIDTPPNSHSDHFPPLTLLLNHNEWQKR
CSICMEIPDCDY
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgaactccaatgatctcaacgacgtagttatcccaggtactcctcccctcccg
agggaactacaaaaattcccctctttgattccaacaaatgatttacgattttcccctaag
tttgatgccgacgttgctaagcttttcccgaatacctatgacagtccttacctaaaattt
acttcaggaactcttgaccaacctgttcgtccattaaaagtaggtgtgatgctatcggga
ggtcctgctcccggaggtcataatgttatttggggattacttcatagcttaaagaaaata
catcccgacagctcgctcattggctttcttaataacggccaagggattctcaataatcat
acagtagaaattaccgaagaattcatggagtctttcaaaaattccggaggattcaactgt
ataggcacaggaagaacaaacatcatcactgaagaaaataaagcccgatgcttaaaaaca
gtacaagctttagaccttgatggtttagtaattattggcggtgatggttcgaatacagca
acggctatcctagcagaatacttttctcagcatcatcctaaaacgtgcgttgtaggcgtc
ccaaaaactattgatggagatcttcaacatctatttttagaccttacctttggatttgat
tcagcaacaaaattttattcctccattattagcaacatttctagagatacgctatcttgc
aaagcgcattaccacgtgatcaagcttatgggacgctctgcatcgcacattgctttagaa
tgcactctacaaacccatccaaatatcactcttataggagaagaaatcgcagaaaagaat
gtgcctctaaatacgataatccataaagtctgttcgatcattgctgatagagccgctatg
gggaaatactatgggattattcttattcctgaaggcattatcgaattcatccctgagatt
aacaaccttgttaaagaaatcgaaagaatccctgaagatgcggataaattttcttctcta
tcccgtgaatctcaaaaattactaaaaagcttcccagaaactatcgctaaacaactcctt
aatgatcgtgatgctcacgggaacgtctatgtatctaaaatcagcgtggacaaattgctt
atccaccttgtagataaccacctgaagaaacattttaaaaatgttccgtttaatgcgatt
tctcattttttaggttatgagggaaggtcgtgcctacccacaaaattcgataatacctac
agctacgccctaggatatggcgcaggagttcttacgtataaccgctgcaacggctacctc
actgtcatcgaatcactgattaatattgtagataaatggcggctacgcgctatgcctatt
gtaaaaatgttcacaacaaagaaaaagtcggatggaactataaaacctctgataaagaag
agtttaattgatattagcagtcctgcttttattaagtttaaactctatagaaaaatatgg
gctctagaagattcttatcgttttttaggaccattacaaattgacaccccgcccaactct
cattccgatcatttccctcctcttactctcctcctcaatcataatgaatggcaaaaaagg
tgttctatatgtatggaaattcctgactgcgattattaa

DBGET integrated database retrieval system