KEGG   Chlamydia psittaci C19/98: CPS0C_0945Help
Entry
CPS0C_0945        CDS       T01863                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
chc  Chlamydia psittaci C19/98
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:chc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1006606..1007874
Genome map
AA seq 422 aa AA seqDB search
MKKAIIIGAGISGLSTAWWLHRKFPNSELVIIDKADRPGGLIYSDYQKNFALDLGPKGFL
VRGEGQYTLGLIRDLQLEEALIVSDKTAKKRFIRYKGKTRKVSPWTLIKEGLPFAIIKDL
FASRYTKDSSVYDFLSRHSTINLIHNVLNPVVTAIRAGHSHLLSAHMAFPSLSQREAKTG
SILRSFLKEPSKKKTSGAPYLASLRPNLGILIDTLVKKLPATWKFSSPVTKIECFPSQVV
VSTTQETFSGDLAIYTGATSLLPSLINIPGLQQLANKTLHWDLSCATLGWNRDMPSIPKG
YGMLFSDEPPLLGIVYNSRVFPNQMPGKTVLSLLLENRWHQEEAFAFSLAAISEYLGIST
KPDVFSLFSPEEGLPQHGVGFLEMKNQILPVLPHNLKIVGQNFSGPGLNRCVASAYQTVA
AI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagccattatcataggcgcaggaatttcagggttatccacagcgtggtggtta
cataggaaattccccaatagcgaacttgtaattatagataaggcagatcgacctggtggg
cttatctactcagattaccaaaagaattttgccttggatctcgggcctaaaggttttcta
gtacgtggtgagggacagtataccctcggattaattcgtgatttacaactggaagaggct
ctcattgttagtgataaaaccgcgaaaaaacgttttatacgttacaaagggaaaacacga
aaagtctccccatggacattaataaaagaaggtttgcctttcgctatcatcaaagatctc
tttgcctcccgctatacaaaagatagctctgtatatgatttcctaagtcgccatagcaca
ataaatcttattcacaatgtattaaatcctgttgttaccgcaattcgtgcaggacacagt
catctactttctgctcatatggccttcccttccctttctcaacgcgaagcaaaaacagga
tccattttacgcagcttcttaaaagaaccttcgaagaaaaaaacatccggagctccttat
ctagcttcgctacgtcccaatctaggcatcctcattgatactttagtaaaaaaactaccc
gcaacgtggaagttttcttctcctgttacaaagatcgagtgtttcccatcccaggttgtc
gtatccactacacaagaaacattctcaggagatctagcaatatatacgggggccacgtct
ctacttccttctcttattaatattccaggactgcaacagcttgcgaataaaactcttcat
tgggatctctcgtgtgcaacattggggtggaatagggatatgccttctatccctaaaggt
tatggtatgctgttctctgacgaaccaccgttattaggtattgtctataactcacgagtc
ttccctaaccagatgcctgggaaaacagttctatcattactattagaaaaccgctggcat
caagaagaagctttcgctttttctttagcagcgatttctgagtatttagggatttctaca
aaacccgatgtattttcattattttccccagaagaaggtctacctcaacacggcgtaggg
tttttagaaatgaaaaatcagatactccctgtacttcctcataatctaaaaattgtcggg
caaaacttctctggtccaggattaaacagatgtgtagcctcagcctatcagactgttgct
gctatctaa

DBGET integrated database retrieval system