KEGG   Chlamydia psittaci C19/98: CPS0C_0976Help
Entry
CPS0C_0976        CDS       T01863                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
chc  Chlamydia psittaci C19/98
Pathway
chc00010  Glycolysis / Gluconeogenesis
chc00260  Glycine, serine and threonine metabolism
chc00680  Methane metabolism
chc01100  Metabolic pathways
chc01110  Biosynthesis of secondary metabolites
chc01120  Microbial metabolism in diverse environments
chc01130  Biosynthesis of antibiotics
chc01200  Carbon metabolism
chc01230  Biosynthesis of amino acids
Module
chc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:chc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS0C_0976
  Energy metabolism
   00680 Methane metabolism
    CPS0C_0976
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPS0C_0976
Enzymes [BR:chc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CPS0C_0976
Membrane trafficking [BR:chc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CPS0C_0976
Exosome [BR:chc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CPS0C_0976
  Exosomal proteins of melanoma cells
   CPS0C_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEG85927
Position
1041030..1041713
Genome map
AA seq 227 aa AA seqDB search
MAFLILLRHGKSVWNEKNLFTGWVDIPLSQKGIDEAMLAGEAIKDLPIDCIFTSSLVRSL
MTALLAMTHHNSKKIPYIVHDDPQHKHMSKIYSDEANHMIPLYRSSALNERMYGELQGKN
KKETAEQFGEEQVKLWRRSYKTAPPKGESLYDTGQRTIPYFHETIFPLLQNSKNVFVSAH
GNSLRSLIMDIEKLSEEEVISLELPTGKPIVYLWTGHTFERHPEPFG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcttatcttattacgacacggaaaatccgtctggaatgaaaaaaaccttttt
acaggatgggtggatatccccctgagtcaaaaaggtattgacgaagcaatgcttgcaggc
gaggcaatcaaagacctccccatagattgtatctttacctcctctcttgtgaggagttta
atgacggcattgcttgctatgacacatcacaattctaaaaaaatcccttacattgttcat
gatgatcctcaacacaagcacatgagcaagatctatagtgatgaagcaaaccacatgatc
ccgctttaccgttccagtgcactaaatgaaagaatgtacggagagctccaaggaaaaaat
aaaaaagaaaccgctgagcaatttggagaggagcaggtaaaattgtggagacgtagttat
aagactgcccctcctaaaggcgaaagtctttacgatactgggcaacgcactatcccctat
tttcatgaaactattttccctttgttgcaaaattcaaaaaatgtgtttgtgtctgcacat
ggaaattcattacgttcactcatcatggatatagaaaaattaagtgaagaagaggtaatc
tctttggagttacccacaggaaaacccatagtgtatttatggaccggtcacacattcgaa
cgacacccagaaccatttggttaa

DBGET integrated database retrieval system