KEGG   Chlamydia psittaci C19/98: CPS0C_1077Help
Entry
CPS0C_1077        CDS       T01863                                 

Gene name
folK
Definition
folate synthesis bifunctional protein (EC:2.7.6.3)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
chc  Chlamydia psittaci C19/98
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:chc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1155118..1156461)
Genome map
AA seq 447 aa AA seqDB search
MITKHFICLSLGSNLGNRFENFRRAFSLLKELGIEDLQSSIILETKALLLPDSPKEWDLP
FFNSVLIGRTALSPKELLSGIKHIERKLGRDPNALPWSPRILDVDILLYGDENYQQDDII
IPHHRILERPFLLSLVASLCPTRKLHQPDSEFHLKTFGEIAHCLPCPQEIILNSFSPTTF
LMGIVNVTDNSISDGGLYIDPSKAVAHAERLFAQGASVIDFGAQATNPKIKQLIDVDQEW
ARLEPVLKLLAEKWSGCMQYPDVSLDTFYPEIIKRALEIYPIRWINDVSGGSKEMAEIAR
DANLLLVINHSCSLPPRPDKTLAFTTCASDQLLSWGKQQIEAFVALGLSKDQIIFDPGIG
FGTTPIQALNVLHRMEKFRELGCATLVGHSRKSCFSLLGKYDAKDRDWETVSLSVLLQQQ
GVNYLRVHDVEANHRVLSAAAWPGVYV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgataaccaagcattttatttgtttatctctaggttccaatctaggaaaccgttttgaa
aattttcgtagagcattttctcttttaaaagagttgggcatagaagatttacaaagttcc
ataattttggagacaaaggctttattgttgcctgactcaccaaaagaatgggacttgcct
ttttttaattccgtacttattggaaggactgcactatctccaaaggagttattgtcaggg
atcaaacatatagaacgtaagcttggtagagatcctaatgccttaccttggtctcctagg
attctggatgtggatattctgttatatggtgatgaaaattaccaacaggatgacatcatc
atacctcatcataggattttagaaagaccgttcttactttctcttgtggcatcgttatgc
cctactagaaaactccatcaaccagattctgaatttcacttaaaaacgtttggagaaata
gcccattgtctaccttgtcctcaggagattattctgaatagcttttctcctactactttt
ttaatgggcatagtgaatgttacggataactccatttctgacgggggattatatattgat
ccttctaaagctgttgctcatgcagagcgattatttgctcaaggggcttccgtaatagac
tttggtgcgcaagcaactaaccctaaaattaagcaattgattgacgtagatcaagagtgg
gcccgtttagagccggtactcaagcttttagcggaaaaatggtcaggatgtatgcaatat
ccagacgtttccttggatacattttatcctgagattattaagagagctttagaaatttat
ccaattcgatggataaatgatgtttctggcggctctaaagaaatggctgagattgccaga
gatgcgaatttattattagttatcaatcattcgtgttctcttcctccacgtcctgataaa
acgttagcttttaccacatgtgcttcagaccagttgctaagctggggaaagcagcaaatt
gaagcttttgttgctttgggattgagcaaagatcaaattatttttgacccaggaataggt
ttcggaacgactcccatacaagcattgaatgtattacacagaatggaaaaattccgagag
cttggttgcgctacgttggtagggcactcaaggaaatcgtgtttctctttgttggggaaa
tatgatgctaaagatcgtgattgggaaactgtgagcttatcggttttgttacaacagcaa
ggcgtgaattacttacgtgttcatgatgttgaagcaaaccacagggtcttatccgcagca
gcatggcctggggtttatgtgtaa

DBGET integrated database retrieval system